SecReT4
Protein ID: 302595441
T4SS name [ID]Trw [152]
Gene symboltraF
Locus tagpECL46p114
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]98844..100007 [+]
Producttype IV conjugative transfer system protein
Component typeTrwE
UniProt IDD9Z5P7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.3e-54, Aligned region: 203..378
Protein Sequence: 387 a.a.     [Download]
>gi|302595441|ref|YP_003829303.1| type IV conjugative transfer system protein [Escherichia coli]
MMARKSVDVDQELDENTGDGEFESERGGFNGSNRRSAPGMKAFVILMALLALVFIGITVMGKIRAPAKAE
ADKDGGKAQQANTLPNYSFNSDPDVNKPATAQNSATDARAVQAAAQADADAGSSNTGARTSNKRKEPSPE
ELAMQRRLGGELAQTNQAATSNSPGVQPQDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMI
PCGTGTELDTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWERIRNDQDGTI
VNIDSAGTNSLGSAGIPGQVDTHMWERLRGAIMISLFSDTLTALVNQTQSNNIQYNSTENSGEQLASEAL
RSYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|302595338|ref|NC_014385.1|:98844-100007 Escherichia coli plasmid pEC_L46, complete sequence
CTGATGGCCCGTAAAAGTGTCGATGTAGATCAGGAACTCGATGAAAACACCGGAGACGGTGAATTTGAAA
GCGAGCGTGGCGGATTTAATGGCAGTAACCGCCGTTCGGCTCCTGGTATGAAAGCCTTTGTCATACTGAT
GGCGCTGCTTGCTTTGGTATTCATCGGGATTACGGTCATGGGTAAAATTCGCGCCCCGGCTAAAGCTGAA
GCTGATAAAGACGGTGGTAAAGCGCAACAGGCCAATACACTGCCAAACTACAGCTTTAACAGCGATCCTG
ATGTTAATAAACCTGCAACTGCGCAGAATAGCGCCACTGATGCCCGTGCTGTGCAGGCTGCCGCACAGGC
AGATGCAGATGCGGGCAGCAGCAATACCGGCGCGCGTACCTCTAATAAGCGTAAAGAACCTTCGCCTGAA
GAACTGGCTATGCAGCGTCGTCTGGGCGGCGAGCTGGCCCAGACTAATCAGGCGGCTACAAGCAATAGTC
CCGGAGTGCAGCCCCAGGACAACGAAACAAGCGAAGGTAGTTCAGCACTCGCTAAAAACCTGACTCCTGC
AAGGCTGAAGGCTAGCCGCGCTGGAGTCATGGCTAATCCCAGCCTGACTGTTCCGAAAGGCAAAATGATC
CCCTGTGGTACCGGCACCGAGCTGGATACCACTGTTCCGGGTCAGGTTTCCTGCCGGGTTTCACAGGACG
TTTACTCAGCTGATGGACTCGTTAGGCTGATTGATAAAGGCTCATGGGTTGACGGGCAGATTACCGGTGG
TATCAAAGACGGCCAGGCGCGCGTGTTTGTTCTCTGGGAGCGTATCCGCAATGACCAGGACGGAACAATC
GTTAATATTGACAGTGCCGGAACGAACTCACTCGGCAGCGCGGGGATTCCGGGCCAGGTGGATACCCATA
TGTGGGAGCGTCTGCGTGGTGCGATCATGATTTCGTTGTTCTCTGACACCTTAACGGCGCTGGTTAACCA
GACGCAGAGTAATAACATTCAGTACAACAGTACAGAAAACAGCGGTGAGCAGCTGGCGTCTGAAGCACTC
CGCTCTTACATGTCTATCCCCCCTACCCTCTACGATCAGCAGGGTGATGCGGTGAGCATTTTTGTTGCCC
GCGACCTCGATTTCAGCGGCGTTTATACGCTCGCAGACAACTAA
 Primer design