SecReT4
Protein ID: 302595517
T4SS name [ID]Tra_F [120]
Gene symboltraL
Locus tagpECL8_p056
StrainEscherichia coli plasmid pEC_L8 (NC_014384)
Repliconplasmid pEC_L8 [GenBank: NC_014384] [Browse all T4SS(s) in this replicon]
Location [Strand]48014..48328 [+]
ProductF pilin assembly
Component typeTraL_F
UniProt IDQ7B3W7, D9Z579
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.4e-37, Aligned region: 10..104
Protein Sequence: 104 a.a.     [Download]
>gi|302595517|ref|YP_003829135.1| F pilin assembly [Escherichia coli]
MMSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRG
SSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 315 bp     [Download]
>gi|302595465|ref|NC_014384.1|:48014-48328 Escherichia coli plasmid pEC_L8, complete sequence
ATGATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCT
GGTTTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAA
ATATCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGC
AGTTCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATG
TTCCCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design