SecReT4
Protein ID: 302595533
T4SS name [ID]Tra_F [120]
Gene symboltraQ
Locus tagpECL8_p075
StrainEscherichia coli plasmid pEC_L8 (NC_014384)
Repliconplasmid pEC_L8 [GenBank: NC_014384] [Browse all T4SS(s) in this replicon]
Location [Strand]62127..62411 [+]
Productconjugal transfer protein
Component typeTraQ_F
UniProt IDD9Z595
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.5e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|302595533|ref|YP_003829151.1| conjugal transfer protein [Escherichia coli]
MISKCRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|302595465|ref|NC_014384.1|:62127-62411 Escherichia coli plasmid pEC_L8, complete sequence
ATGATAAGTAAATGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCTCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAGCAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design