SecReT4
Protein ID: 302595543
T4SS name [ID]Tra_F [120]
Gene symboltraX
Locus tagpECL8_p085
StrainEscherichia coli plasmid pEC_L8 (NC_014384)
Repliconplasmid pEC_L8 [GenBank: NC_014384] [Browse all T4SS(s) in this replicon]
Location [Strand]76339..77556 [+]
ProductF pilin acetylation protein
Component typeTraX_F
UniProt IDD9Z5A5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.7e-52, Aligned region: 189..404
Protein Sequence: 405 a.a.     [Download]
>gi|302595543|ref|YP_003829161.1| F pilin acetylation protein [Escherichia coli]
MPVKVVRGIPVPSPVAACGGISRITASSRGPEMANRSRQRYWHSGRLKRPSAVKRNAAQMKLSGKWQRTN
LTCRTAKQSWLSGILPDRSVTGLPYLNGKPHCRRVCCVNHNGSGKRSGRLPGKICCRSVCSRWSGIWFVT
CRKRKPWAETDTGRQTLMTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIF
QLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVA
AQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERLALLACLLAVIPAL
NLASSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 1218 bp     [Download]
>gi|302595465|ref|NC_014384.1|:76339-77556 Escherichia coli plasmid pEC_L8, complete sequence
TTGCCGGTGAAGGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGCCGCGTGTGGGGGGATATCCCGGA
TAACAGCGTCCAGCCGGGGGCCGGAAATGGCGAACCGGTCACGGCAGAGGTACTGGCACAGCGGCAGGCT
GAAGAGGCCATCCGCCGTGAAACGGAACGCCGCGCAGATGAAATTGTCAGGAAAATGGCAGAGAACAAAC
CTGACCTGCCGGACGGCAAAACAGAGCTGGCTGTCAGGGATATTGCCGGACAGGAGCGTGACCGGTCTGC
CATATCTGAACGGGAAACCGCACTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAGCGGGAAGCGGTC
CGGGAGGTTGCCCGGGAAAATCTGCTGCAGGAGCGTCTGCAGCAGATGGAGCGGGATATGGTTCGTGACC
TGCAGAAAGAGAAAACCCTGGGCGGAGACTGATACAGGAAGACAAACACTGATGACAACGGATAACACGA
ACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGTCGTTTCTGGTCTGGTCACC
CGGACAGCGGGATATCATCAAAACGGTGGCGCTGGTGCTGATGGTACTGGACCACATCAATCTGATATTC
CAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTGTTTGCCCTGGTGTGGGGGC
TGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGTGGGGATGGGGAATTATTGC
CCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCTGTTTGCCTTTGCAGTGGCG
GCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCGGCCATTCTTCTGATGGCCC
TGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGCTGGCGGTCAGTTACCGACT
GTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGCTTGCATGCCTGCTGGCCGTTATTCCGGCACTT
AACCTTGCCTCCAGTGATGCAGCGGCGGTGGCCGGTCTTGTAATGACGGTGCTGACCGTTGGTCTGGTGT
CGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGGTATTCTACGCCTGTCATCT
GGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design