SecReT4
Protein ID: 304311448
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18160
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2266744..2267553 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDE1VKQ7
KEGG IDgpb:HDN1F_18160, gpb:HDN1F_35030
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.3e-38, Aligned region: 50..266
Protein Sequence: 269 a.a.     [Download]
>gi|304311448|ref|YP_003811046.1| unnamed protein product [gamma proteobacterium HdN1]
MASNESAGAQSAPQPLHWQIAFLPFVLLGLAIGACVSAIMIEWAGMALGVWDLPGAGHARETLVGDIQYL
NADFTRSILGVSPVELAVIASRTTTEWIVLKIESLGVMEMMQQLGQEGSSGVFSSLFKSVDTGLSSISAN
AAETSASLAAPNQLYHGLMQYFDAAIYAVQTVVVRIVVAILSLPAYLLIGLVCLLDGIVARDLRRFTAAN
ESSFAYHRYKPWVVRFFVVSWYAYIAWPTSIHPNAVFVPSALLCGWATFNTAKWFKKFF
 
Nucleotide Sequence: 810 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2267553-2266744 Gamma proteobacterium HdN1 chromosome, complete genome
ATGGCCTCAAATGAATCCGCAGGCGCACAAAGCGCTCCACAGCCGCTTCATTGGCAAATTGCATTTCTCC
CTTTCGTCTTGCTTGGGTTGGCCATCGGCGCGTGTGTTTCGGCGATCATGATTGAATGGGCAGGGATGGC
GCTGGGCGTCTGGGATTTACCGGGAGCTGGTCATGCTCGCGAAACGCTGGTGGGCGATATTCAATACCTG
AACGCTGATTTTACGCGCTCAATTCTGGGTGTATCCCCCGTCGAGTTGGCCGTGATTGCAAGCCGTACGA
CGACCGAATGGATCGTGCTCAAAATCGAATCTCTTGGCGTGATGGAGATGATGCAGCAACTTGGCCAAGA
AGGATCATCAGGCGTGTTTTCAAGCCTGTTCAAAAGTGTCGATACAGGGCTGTCCTCAATCTCAGCGAAT
GCGGCGGAGACAAGCGCCAGCTTGGCGGCGCCGAATCAACTGTATCACGGGCTGATGCAGTATTTTGATG
CGGCAATTTACGCGGTACAGACGGTAGTGGTGAGGATTGTGGTTGCGATCCTGAGCTTGCCCGCCTATCT
GCTGATTGGCCTCGTCTGTCTGTTGGATGGCATCGTTGCGCGGGATCTGCGCAGATTTACGGCTGCGAAT
GAGTCGTCTTTTGCGTATCACCGCTACAAGCCGTGGGTGGTGCGCTTTTTTGTTGTCAGTTGGTATGCCT
ATATCGCGTGGCCCACGTCCATTCACCCCAATGCCGTATTTGTTCCGAGTGCGCTTTTGTGTGGGTGGGC
GACGTTTAATACCGCGAAATGGTTCAAAAAGTTTTTCTAA
 Primer design