SecReT4
Protein ID: 304311451
T4SS name [ID]Tfc [766]
Gene symbol-
Locus tagHDN1F_18190
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]2270261..2270800 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDE1VKR0
KEGG IDgpb:HDN1F_18190, gpb:HDN1F_35000
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 179 a.a.     [Download]
>gi|304311451|ref|YP_003811049.1| unnamed protein product [gamma proteobacterium HdN1]
MSTASGLRRFIGALLLTVSAYADAGVPAAYQAVASQYGVPPEVLYAIALTESRHTVSGLVRPWPWTANVE
GKPYFFASRTEMSAFLTGLLRRGNRKFDVGLMQISWRHHGHRFRSVDEAIDPLTNLQAGAAYLRYLIKRR
GVENAIGMYHTGEAGPMDRQRHYRKLVYASLDRIRSGRI
 
Nucleotide Sequence: 540 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c2270800-2270261 Gamma proteobacterium HdN1 chromosome, complete genome
GTGAGCACTGCAAGCGGATTGAGACGCTTTATCGGGGCTCTATTGCTCACCGTCAGTGCCTATGCAGATG
CGGGTGTGCCCGCAGCGTATCAGGCAGTCGCGAGCCAGTACGGTGTGCCGCCGGAGGTGCTGTATGCCAT
TGCACTGACCGAGTCTCGACATACCGTAAGCGGCCTCGTGCGGCCTTGGCCGTGGACGGCCAATGTGGAG
GGAAAACCGTATTTTTTTGCGTCACGTACGGAGATGTCCGCCTTTCTCACTGGGTTGTTGCGGCGCGGTA
ATCGAAAATTTGATGTGGGCTTGATGCAAATTTCGTGGCGTCATCACGGCCATCGGTTTCGCAGTGTGGA
TGAGGCCATTGACCCGCTGACCAATCTGCAAGCTGGGGCCGCATATCTACGTTACCTGATCAAACGGCGA
GGTGTTGAAAATGCGATCGGTATGTATCACACGGGTGAAGCGGGCCCAATGGATCGCCAACGCCATTACC
GGAAACTTGTGTATGCCTCACTCGATCGCATCCGTTCTGGGAGAATTTAG
 Primer design