SecReT4
Protein ID: 304313119
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35040
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4246227..4246628 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDE1VKQ6
KEGG IDgpb:HDN1F_18150, gpb:HDN1F_35040
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.6e-08, Aligned region: 56..128
Protein Sequence: 133 a.a.     [Download]
>gi|304313119|ref|YP_003812717.1| unnamed protein product [gamma proteobacterium HdN1]
MMPLIPYSCDGSTLMLFARHDHPKHKKHKIIVPILLGSTLALALGVASVQAQPYASPAAEMERAKLAEIV
SALDQLVVQVDDASKTGASGRVRFNYDALRRDLLGRRALIQRYVNGAWDEAHDLPPLAKTYQR
 
Nucleotide Sequence: 402 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4246227-4246628 Gamma proteobacterium HdN1 chromosome, complete genome
ATGATGCCACTCATCCCATACAGCTGCGACGGGAGTACGCTGATGTTGTTCGCGCGCCATGATCATCCAA
AGCACAAAAAACACAAAATTATTGTGCCAATCCTTTTAGGAAGCACGCTGGCGCTAGCGCTGGGTGTTGC
GAGTGTGCAGGCGCAGCCTTACGCAAGCCCAGCGGCAGAGATGGAACGCGCCAAGCTTGCGGAAATTGTC
TCTGCGCTGGATCAGTTGGTGGTTCAAGTGGATGACGCGAGTAAAACCGGCGCCAGTGGGCGCGTCCGTT
TTAATTACGATGCGTTACGGCGAGATTTGCTGGGGCGACGTGCACTGATTCAGCGGTATGTGAATGGTGC
GTGGGACGAGGCGCACGACCTGCCGCCGCTGGCAAAAACCTACCAGCGTTGA
 Primer design