SecReT4
Protein ID: 304313131
T4SS name [ID]Tfc [767]
Gene symbol-
Locus tagHDN1F_35160
Straingamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T4SS(s) in this replicon]
Location [Strand]4257204..4258610 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDE1VKP3
KEGG IDgpb:HDN1F_18020, gpb:HDN1F_35160
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|304313131|ref|YP_003812729.1| unnamed protein product [gamma proteobacterium HdN1]
MDIQPRQPRFSKRTKKALLLFSLMLTPCLPVTLGHAEPLTKYVDDFFYKLNGGRAIPRGAAGYITYRVGA
RFTANPGYTCGKFKMENNLKQAFENMKTQLSGLPGQISTAATEMVAALPMYLVKTYAPDIYGILTWNLDQ
AIELFRFEYKTCEMLESEMAKAEGEHNPYNTALRASVMNQWKYGAENNQSINQTSQEIKENPGRKGFDFL
GKGRGTKENPVPIKHDLMVLAYNNRIGRTNEPLNESAPPDDQKNLALVQIWPTPKAAADWVVAATGEFWI
VVDDEKPKSAPGVGIRPEIDLLTDRYEQAIVNAVNLDDFQELDELGLTVPPNLRISDRVISALRNLPDDK
RAVATSRLASDTAVAIVKNKADLATTLFRSAVQDPDVATSQISSIAAKVSDDTRKWLSEEMEEVATSMQM
ARIGLGTTPLLIMGQSMVETLKKSTQTGSSPKNNNPAIQGGYPVAPAP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|304309652|ref|NC_014366.1|:4257204-4258610 Gamma proteobacterium HdN1 chromosome, complete genome
ATGGACATTCAACCCCGCCAACCCCGCTTTTCCAAACGCACCAAGAAAGCCCTGTTGCTGTTCAGCCTGA
TGCTCACCCCCTGCCTGCCGGTGACGCTCGGCCACGCCGAACCGCTGACCAAGTACGTGGATGATTTTTT
CTACAAATTAAACGGTGGTCGGGCCATTCCGCGCGGCGCTGCTGGATATATCACCTATCGGGTGGGCGCT
CGATTCACCGCAAATCCTGGCTACACCTGCGGCAAGTTCAAAATGGAAAACAATCTGAAGCAGGCATTTG
AAAACATGAAGACGCAGCTATCGGGTTTGCCGGGCCAGATTTCCACGGCAGCCACGGAGATGGTAGCCGC
CCTGCCCATGTACCTTGTAAAAACCTACGCACCCGACATTTACGGCATTTTAACGTGGAACCTCGATCAA
GCCATCGAGCTGTTCCGCTTTGAGTACAAAACTTGCGAAATGCTGGAATCGGAAATGGCGAAAGCCGAGG
GAGAGCACAACCCCTACAATACGGCCCTTCGCGCATCGGTCATGAACCAGTGGAAATACGGCGCCGAAAA
CAACCAGAGCATTAACCAGACCTCGCAAGAAATCAAAGAGAACCCCGGACGCAAAGGCTTTGATTTTCTG
GGGAAAGGGCGCGGAACCAAGGAGAATCCGGTGCCGATCAAACACGATTTAATGGTGTTGGCGTACAACA
ACCGTATTGGCCGCACCAACGAACCCCTGAACGAATCTGCCCCGCCGGACGATCAAAAAAACCTCGCCTT
GGTGCAGATATGGCCCACTCCCAAAGCCGCCGCCGATTGGGTGGTAGCCGCCACCGGCGAATTCTGGATT
GTGGTAGATGACGAAAAACCGAAAAGCGCCCCCGGTGTGGGCATCCGCCCTGAAATCGACCTGCTGACCG
ATCGTTACGAGCAGGCCATTGTGAACGCCGTCAATCTGGATGATTTTCAAGAGCTCGACGAGTTGGGGCT
TACCGTCCCTCCAAATCTGCGCATTTCCGACCGTGTGATCAGCGCCCTGCGCAACCTGCCCGACGACAAA
CGCGCCGTAGCCACCAGCCGCCTCGCATCAGACACCGCCGTCGCCATCGTGAAAAACAAGGCAGACCTTG
CGACTACCCTGTTCCGATCTGCCGTACAAGATCCGGATGTAGCGACCTCGCAAATCTCCAGCATTGCCGC
AAAGGTGTCTGACGACACCCGCAAATGGCTGAGCGAGGAGATGGAGGAAGTCGCCACCTCGATGCAAATG
GCCCGCATTGGCTTGGGCACTACACCGCTCTTGATCATGGGCCAAAGCATGGTAGAGACGCTGAAAAAAT
CCACGCAGACGGGCAGCTCCCCCAAAAACAACAACCCCGCCATCCAAGGCGGCTACCCAGTAGCACCTGC
ACCTTAG
 Primer design