SecReT4
Protein ID: 304319695
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00582
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]8800..10839 [+]
Productprotein TraD
Component typeTraD_F
UniProt IDE0TAY8
KEGG IDpbr:PB2503_00582
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 7.1e-145, Aligned region: 185..567
TraG-D_C [PF12696], Evalue: 2.1e-19, Aligned region: 426..548
T4SS-DNA_transf [PF02534], Evalue: 2.5e-13, Aligned region: 388..549
AAA_10 [PF12846], Evalue: 1.2e-10, Aligned region: 200..238
AAA_10 [PF12846], Evalue: 1.2e-10, Aligned region: 409..508
Protein Sequence: 679 a.a.     [Download]
>gi|304319695|ref|YP_003853338.1| protein TraD [Parvularcula bermudensis HTCC2503]
MSGNASGPFKTFLRGGQVTLHTLRMFGQVMRFLSFAMVSLMLVIAWAGVMVNTAPEDRHYAMKRYEAWAY
RAAGFRESLELNMRTADGSHAPFPIGTILTHPAVAEHEKRFRRQLFVWGRIGGLGGGFGFLLLTGLFVGR
GSTLTRTNVKRGAAMASAQELKAQIGAHNRWTAMKRKELRGRPRYALAGIPYPVGSEVQHTGISGTIGSG
KTQAIAALLDQIRKAGDRAVVFDLTGGFIAPFYREDRDTILNPLDRRAPAWSVFDEAKTKAGFDAIAAAM
IPRAQKADPVWADSARMVFSTAGQLLLGDGRASNKELVDLLLNAELRTLAPFFAGTPAASIISADTPRMT
NSVRMMLSTYLDGLRLLPSRGDRFSITEWIENDRAGSTLFLSSRADMHETLRPLLTVWMDTAVRALMSRP
RDPNRRIWFIMDEVAALQELPSIMDGLARGRQFGAAFVLGIQAQSQLRDIYGPDGAQTLSSVCRTKLILA
ASDADTAKWYADFLGRQETSRSNENVSFGANTIRDGVMLARQERIEHLVIPEEIMNLRSLEGYLKMPEGF
PLAKVKVPLVLREDREPAFLPREDQGLLITRARAPHTVKAMQATAHRPGSEDGQRDMFSEAERDGIDELI
DPDTGEVSATTRVEGVAQDGAEGADPPSPPDRPRPRDIGQDFPDWGFEP
 
Nucleotide Sequence: 2040 bp     [Download]
>gi|304319677|ref|NC_014414.1|:8800-10839 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGAGCGGGAACGCATCGGGCCCCTTCAAGACCTTCCTGCGCGGCGGGCAGGTCACCCTCCACACGCTCC
GCATGTTCGGTCAGGTCATGCGGTTTCTGAGCTTCGCCATGGTCTCGCTGATGCTGGTCATCGCTTGGGC
GGGCGTCATGGTGAACACCGCGCCCGAGGACCGCCATTATGCGATGAAGCGATATGAGGCCTGGGCGTAC
CGGGCCGCCGGGTTCCGAGAGAGCCTCGAGCTCAACATGCGGACAGCGGACGGGAGCCATGCGCCCTTCC
CCATCGGCACCATCCTCACCCATCCGGCCGTGGCCGAGCATGAGAAACGGTTCCGCCGTCAGCTCTTCGT
CTGGGGGCGGATCGGCGGGCTTGGCGGGGGCTTCGGTTTCCTCCTTCTGACCGGCCTTTTCGTTGGCCGG
GGCAGCACCCTGACCCGCACCAATGTCAAACGCGGCGCCGCCATGGCGTCCGCGCAGGAGCTCAAGGCGC
AGATCGGTGCCCACAACCGCTGGACCGCGATGAAGCGGAAAGAGCTCCGGGGGCGGCCCCGCTATGCCCT
TGCCGGCATCCCCTATCCGGTCGGTTCGGAGGTCCAGCATACGGGGATCTCCGGCACCATCGGTTCGGGC
AAGACCCAGGCGATCGCCGCCCTTCTCGACCAGATCCGCAAGGCCGGTGACCGAGCCGTGGTGTTCGACC
TGACCGGCGGGTTCATCGCGCCCTTCTACCGCGAGGATCGCGACACCATTCTCAACCCGCTCGACCGGCG
GGCCCCCGCCTGGTCGGTGTTCGACGAGGCGAAGACCAAGGCGGGGTTCGACGCCATCGCAGCGGCCATG
ATCCCCCGGGCCCAGAAGGCCGATCCGGTCTGGGCCGACTCGGCGCGGATGGTGTTCTCCACCGCCGGTC
AGCTTCTCCTGGGGGACGGCCGGGCGAGTAACAAGGAGCTCGTCGATCTCCTGCTGAATGCGGAACTCAG
GACGCTGGCGCCCTTCTTCGCCGGGACCCCCGCGGCGTCGATCATCTCGGCAGACACGCCGCGCATGACC
AATTCCGTGCGGATGATGCTGTCGACCTATCTCGACGGCTTGCGGCTCCTCCCGAGCCGGGGCGACCGCT
TTTCGATCACCGAGTGGATCGAGAACGACCGCGCGGGGTCGACCCTCTTCCTCTCCTCAAGAGCGGACAT
GCACGAGACCCTGAGGCCGCTTCTCACCGTCTGGATGGACACGGCCGTCAGAGCGCTGATGTCCCGACCG
CGCGACCCGAACAGGCGGATCTGGTTCATCATGGACGAGGTCGCCGCGCTCCAGGAGCTTCCCTCCATCA
TGGACGGGTTGGCGCGGGGCCGTCAGTTCGGGGCAGCTTTCGTCCTCGGCATCCAGGCGCAATCGCAGCT
CAGGGACATTTACGGGCCCGACGGCGCGCAGACCCTTTCCTCGGTCTGCCGGACCAAGTTGATCCTCGCC
GCCTCCGACGCCGACACCGCCAAATGGTATGCGGACTTTCTCGGGCGGCAGGAGACCTCCCGCTCCAACG
AGAATGTCTCCTTCGGCGCGAACACCATCCGGGACGGGGTCATGCTGGCCCGGCAGGAGCGGATCGAGCA
TCTCGTCATACCCGAAGAGATCATGAATCTCCGTTCTCTCGAGGGCTATCTCAAGATGCCCGAGGGCTTC
CCCCTGGCGAAGGTGAAGGTGCCGCTGGTCCTGCGCGAAGACCGGGAACCGGCTTTCCTGCCGCGAGAGG
ATCAGGGCCTCCTCATCACCCGGGCGCGGGCGCCGCACACGGTCAAAGCCATGCAGGCCACCGCGCACCG
ACCTGGCAGCGAGGATGGCCAGCGGGACATGTTCAGCGAGGCCGAACGGGACGGCATCGACGAGTTGATC
GATCCCGACACCGGCGAGGTGTCGGCGACGACGCGAGTGGAAGGCGTGGCGCAGGACGGGGCCGAAGGGG
CCGATCCCCCCTCACCGCCCGATCGTCCACGCCCCCGTGACATCGGCCAGGACTTTCCCGATTGGGGGTT
TGAGCCCTGA
 Primer design