SecReT4
Protein ID: 304319696
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00587
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]10839..13823 [+]
ProductTrwC protein
Component typeTraI_F
UniProt IDE0TAY9
KEGG IDpbr:PB2503_00587
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 1.5e-72, Aligned region: 8..283
AAA_30 [PF13604], Evalue: 6e-42, Aligned region: 470..663
Viral_helicase1 [PF01443], Evalue: 1.8e-09, Aligned region: 869..919
AAA_19 [PF13245], Evalue: 4.6e-08, Aligned region: 477..550
UvrD_C_2 [PF13538], Evalue: 1.7e-07, Aligned region: 817..919
Protein Sequence: 994 a.a.     [Download]
>gi|304319696|ref|YP_003853339.1| TrwC protein [Parvularcula bermudensis HTCC2503]
MVASIAAVSSASAGAAYYGKDNYYAKGGDAPEPSSWFGKGAASLGLKGGVETETFERVLNGETLDGRRVG
QREGETAEQAQARAHRPGIDLTFSPPKDVSLLLYIGGDKRILGAHRAAVDQTLKWAERNLAGTRIRTGPS
ATPAVKTGNLVIARFEHDISRDKDPQLHTHAVIANITKTDDGRWRALHNDPFFAHRKTLSLAYDATLRNA
LRELGYRVKLEDGKSGRYSVDGVPDGARAEFSKGKDRIDSAAVGLKHPTPSARDKLAVKTRPAKDELRQE
ERVALRETRGAPWKATLEHTVAVSVERQAQGHLQRPLDDRAVGRVGMEGLARRMAQNLFRPTKTLRLSEN
DPYKLERAASEKGYSARAAVSFGLRHHEEREAAFSLHHVRRTALEHAADGVTLRDIDRELRFLRANRKLL
VNAKDPNAESTTKRSLTHEERTLSLLQDAGRTGPLVPEQTLRSALESTHLTGGQKAAIGLILGGPNRLVG
VQGYAGTGKTTMMRQTAALARDLAPLAKKDGYKVLGLAPTHSARKTLEESGGFDSRTVSAFLREAGGGTL
PPDIKNTIVLIDEASFLSTRNMNALLERLIALKPAKIVLSGDRRQHGAVEAGRPFDIAQRAGLPTAIMKD
IVRLPKDEGHRDQRAAVEAAAQGKVAVAMKRLGANIVERPGNLAGGAVEAWRALPKDKQDKALLVAPSHR
LREAINQGIRSELIANGRLSAETMTISVLRSKNLTRAEAMSPRSYAAGDILQFHARLDAINAKKNTRRLV
TAVDEERGRLTLRNARGKDQTVPLSRLQGRYENTPYSLHREEPLELRRGDSVMFTRSNPDAGLSAMDAAK
VVGWDQERVSLNVSGTQRQFGRDDPALRSLTHGYAMTSHAAQGRTAKDVVAVMDSKERALTSQVGFYVSI
SRSADTLALIVNDKERVLNTMQRQTGLKTSAMETEGRIGDLTDLGTHQGTGTTSSLSVPALAADQRNEAT
GNEQDSSLDQGLSL
 
Nucleotide Sequence: 2985 bp     [Download]
>gi|304319677|ref|NC_014414.1|:10839-13823 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGGTCGCCTCGATCGCCGCCGTCTCCTCGGCCTCCGCCGGGGCGGCCTATTACGGCAAGGACAATTACT
ACGCGAAGGGCGGGGACGCGCCCGAACCCTCGTCCTGGTTCGGCAAGGGCGCCGCCAGCCTCGGCCTCAA
GGGCGGGGTCGAGACCGAAACCTTCGAACGGGTGCTGAACGGCGAGACGCTCGACGGTCGCCGAGTCGGT
CAACGCGAAGGCGAGACCGCCGAGCAGGCCCAGGCCCGCGCCCACCGGCCCGGCATCGACCTCACCTTTT
CGCCGCCCAAGGATGTTTCCCTCCTCCTCTATATCGGTGGCGACAAGCGCATTCTCGGCGCCCACCGGGC
GGCGGTCGACCAGACCCTCAAATGGGCCGAGAGAAACCTGGCGGGGACGCGGATCCGGACGGGGCCCAGT
GCGACCCCAGCGGTAAAGACCGGCAATCTCGTCATCGCCAGGTTCGAGCACGACATCTCGAGGGACAAGG
ACCCGCAGCTCCACACCCATGCCGTCATCGCCAATATAACGAAGACGGATGACGGGCGCTGGCGGGCGCT
CCACAATGATCCCTTCTTCGCCCATCGGAAGACTCTGAGCCTCGCCTATGACGCGACCTTGCGGAACGCC
CTGCGGGAACTCGGCTATCGGGTGAAGCTCGAGGACGGCAAGTCCGGGCGATATTCCGTAGACGGTGTTC
CCGACGGGGCACGAGCCGAGTTCTCGAAAGGCAAGGACCGGATCGACAGTGCCGCCGTCGGACTCAAGCA
CCCGACGCCGTCCGCCCGGGACAAGCTCGCGGTCAAGACGCGGCCCGCCAAGGACGAACTCCGCCAGGAG
GAACGTGTGGCCCTTAGGGAAACCCGCGGGGCGCCCTGGAAGGCGACGTTGGAGCACACCGTCGCCGTAT
CAGTAGAGCGACAGGCGCAAGGCCATCTACAACGACCGCTCGATGACCGGGCCGTTGGGCGCGTCGGCAT
GGAAGGTCTCGCGCGGCGGATGGCGCAGAACCTGTTCCGGCCGACCAAGACCCTCCGCCTTTCCGAGAAC
GATCCGTACAAGCTCGAACGCGCCGCCTCCGAGAAAGGTTATTCCGCACGCGCTGCCGTCAGCTTCGGCC
TGCGCCACCACGAAGAGCGGGAAGCCGCCTTCTCTCTCCACCATGTCCGGCGCACCGCGCTCGAACACGC
CGCCGACGGGGTCACCTTGCGCGACATCGACAGGGAGCTTCGTTTCCTCAGGGCGAACCGAAAGCTGCTG
GTGAACGCGAAAGACCCGAACGCGGAGAGCACGACGAAGCGGAGCCTGACCCATGAGGAGCGCACGCTCT
CGCTCTTGCAGGATGCCGGACGCACCGGTCCGCTGGTTCCCGAGCAGACCCTGAGGAGCGCTCTCGAGAG
CACCCATCTTACCGGTGGCCAGAAAGCCGCTATCGGCCTGATCCTCGGCGGTCCAAACCGGCTTGTCGGC
GTGCAGGGCTATGCTGGGACGGGCAAGACCACCATGATGCGCCAGACGGCAGCGCTCGCCCGCGACCTCG
CGCCGCTCGCGAAGAAGGACGGCTATAAGGTGCTAGGCCTCGCCCCTACCCATTCGGCAAGGAAGACGCT
CGAGGAGAGCGGCGGCTTCGACAGCCGGACCGTTTCGGCCTTCCTAAGGGAGGCAGGGGGCGGGACGCTT
CCGCCGGACATTAAGAACACCATCGTCCTCATCGACGAAGCGTCTTTCCTCTCCACCCGGAACATGAACG
CGCTCCTCGAACGCCTGATCGCCCTGAAGCCTGCCAAGATCGTCCTCTCGGGTGACCGGCGGCAGCATGG
CGCGGTGGAGGCCGGGCGGCCCTTCGACATCGCGCAGCGGGCGGGCCTACCGACCGCGATCATGAAGGAT
ATAGTCCGCCTGCCGAAGGACGAAGGGCACCGCGATCAGCGGGCGGCGGTGGAAGCGGCAGCGCAGGGCA
AGGTCGCCGTCGCCATGAAGCGGCTGGGGGCCAACATCGTCGAGCGACCCGGCAACCTTGCCGGCGGTGC
CGTCGAGGCATGGCGCGCCCTGCCGAAGGACAAACAGGACAAGGCGCTGCTCGTCGCCCCGAGCCACCGC
CTGCGAGAGGCGATCAATCAGGGTATCCGATCGGAGCTGATCGCCAATGGACGGCTGAGCGCGGAGACAA
TGACCATCTCGGTGCTGCGGTCAAAAAACCTGACCCGGGCCGAGGCGATGAGCCCGCGCAGCTATGCGGC
TGGCGACATCCTCCAATTCCATGCCCGGCTCGATGCCATCAACGCGAAGAAGAATACGCGCCGGCTCGTC
ACCGCAGTTGACGAAGAGCGCGGCCGCCTCACCTTGCGCAATGCCCGCGGAAAGGATCAGACGGTGCCGC
TCTCGCGCCTTCAGGGTCGCTATGAAAACACCCCCTACTCGCTTCATCGGGAGGAACCGCTCGAGCTGCG
CCGCGGCGACAGCGTGATGTTCACAAGGTCCAATCCTGACGCGGGCCTGTCCGCGATGGACGCGGCGAAG
GTGGTCGGCTGGGACCAGGAGAGGGTTTCGTTGAATGTGAGCGGAACGCAGCGCCAGTTCGGGCGCGACG
ATCCAGCGCTCCGCTCACTGACCCATGGCTATGCGATGACCTCCCATGCCGCTCAAGGCCGAACGGCGAA
AGACGTGGTCGCCGTGATGGATTCGAAGGAACGGGCACTCACGAGCCAAGTCGGGTTTTACGTGTCGATC
AGTCGGTCAGCCGATACCCTTGCGCTCATTGTGAATGACAAAGAGCGTGTACTGAACACGATGCAGCGAC
AGACGGGACTGAAGACGTCGGCGATGGAGACGGAAGGACGGATTGGGGATTTGACCGATCTCGGAACGCA
TCAGGGCACGGGCACGACAAGCAGTCTGTCGGTGCCTGCCTTAGCAGCCGACCAGAGAAACGAGGCAACC
GGCAACGAGCAAGACAGCTCTCTCGATCAAGGTCTGTCGCTCTGA
 Primer design