SecReT4
Protein ID: 304319706
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00637
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]28594..31512 [-]
Productprotein TraG
Component typeTraG_F
UniProt IDE0TAZ9
KEGG IDpbr:PB2503_00637
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.7e-116, Aligned region: 2..465
Protein Sequence: 972 a.a.     [Download]
>gi|304319706|ref|YP_003853349.1| protein TraG [Parvularcula bermudensis HTCC2503]
MEVITYGGGEFIRDMFNAVAAVVGMGAFASALRLSLVLGLLFVLFQTAFSLNFWTTIRWFVTSLIIYLCL
LVPKVEVQITDRFDPGLPGATVANVPLGLALIASLTTTVGDRFTEVTETAFALPTDLEYQENGFIYGSKL
FKDSMSFRVTDATFGQNLSGFIRTCVFYDLLEHRYSVTDLRETDDLWTFVTVTQPPNPARFYEYVTGPGA
TEVKSCDEAATTLDGLWAGEANRIAQIYGKQVAPNLTEAAAQALILGSLAEAHDFFLGSARSASDQIRQA
TLGNLIDKAVRDQGAELGADALLDAYGQARMESEMAHAIRQGSRLAERFVPLFRTVAEALFYGLFPVLFP
IFLLPSIGERFLRGYVGGFVTLMAWGPIYVILHRIMMGTAGFRSAGAAYTPTSGEAITLVTQTGIETVHS
DIAMIAGYMTLMVPFAAGALGRGAMAFAGLSQSFLHPAQMAAQSAARETSTGNMSLGNTSFDTHRFNSVD
GNRLATSSFVDTGEGSWNTPEGGRMRMTAGGARVYDGMGAISRGATHVDYQGGLSTALQSEASWSLEQRD
AAANRSSEARTALAHNVADLTWQMNEGRSFEDVTGYGQDTRMAESASKLLTNASRFAERFAEGKDTRMAI
EAYIAASASKGVTVPLLGSAKVEAGGKASAAWEARRSEIYEAAREAVRTDGSQDTYDDVVSTFERGSSSE
SGQETNAWREAFAANLQESQTASRDLEHYQARSDAARNLASHIEREGSGFTANWDNAFLNHMATQERGDG
HVIGVNEAARRWTSGDLADRMWVEAEARNFIEDQAAHLLDRPELGGFRMPEGPGGSPSDFEAIDQVGAEY
RSDAEAQSDVTFNAARAEQIEGTAYWTGQRHEQSVAAMRGDDEELARLRKLTVQSRVQDSRDAEWDEFAR
QDPDEMSEDEANIWRKAKRSPGVGSTPVDGEQQRSDEERMPDFQPFGQIEHFKTGADRLTAD
 
Nucleotide Sequence: 2919 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c31512-28594 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGGAGGTCATCACCTATGGCGGCGGCGAGTTCATCCGCGACATGTTCAACGCCGTTGCGGCCGTGGTCG
GCATGGGCGCCTTCGCCTCGGCCCTCAGGCTGTCCCTCGTCCTCGGCCTTCTCTTCGTTCTCTTCCAGAC
CGCCTTCTCGCTCAATTTCTGGACGACCATCCGCTGGTTCGTCACCAGCCTGATCATCTATCTCTGCCTC
CTCGTTCCGAAGGTGGAAGTGCAGATCACGGACCGCTTCGACCCCGGGCTGCCCGGTGCGACCGTTGCCA
ATGTGCCCCTCGGTCTCGCGCTTATTGCGAGCCTCACCACCACCGTCGGCGACCGGTTCACCGAAGTGAC
CGAGACCGCCTTCGCGCTTCCCACCGACCTCGAATATCAGGAGAACGGCTTCATCTATGGCTCGAAGCTC
TTCAAGGATTCGATGTCTTTCCGGGTGACCGACGCGACCTTCGGCCAGAACCTTTCGGGCTTCATCCGGA
CTTGCGTCTTCTACGACCTTCTCGAGCACCGCTATTCGGTGACGGATCTGCGGGAGACGGACGATCTCTG
GACCTTTGTCACTGTCACGCAGCCACCGAACCCGGCCCGCTTCTATGAATATGTCACTGGCCCCGGCGCG
ACGGAGGTCAAATCCTGCGATGAGGCGGCGACGACCCTCGACGGCCTTTGGGCGGGGGAGGCGAACCGGA
TCGCGCAGATCTACGGCAAGCAGGTGGCGCCCAACCTCACCGAGGCAGCGGCGCAGGCGCTGATTCTCGG
CTCCCTCGCCGAAGCCCATGACTTCTTCCTTGGCTCTGCCCGGTCGGCCTCCGACCAGATTCGTCAGGCG
ACCCTTGGCAATCTCATCGACAAGGCGGTGCGCGATCAGGGGGCGGAGCTTGGTGCCGACGCACTGCTCG
ATGCCTATGGCCAGGCGCGCATGGAGAGCGAGATGGCGCACGCCATCCGGCAGGGCTCACGCCTCGCCGA
ACGCTTCGTGCCGCTCTTCCGGACCGTGGCCGAGGCGCTTTTCTACGGTCTCTTCCCGGTCCTGTTCCCG
ATCTTCCTCCTGCCCTCGATCGGCGAGCGGTTCCTGCGCGGCTATGTCGGGGGCTTCGTCACCCTCATGG
CCTGGGGACCGATCTATGTGATCCTCCATCGGATCATGATGGGCACGGCAGGTTTTCGGTCGGCCGGCGC
CGCCTACACGCCGACCTCGGGGGAGGCGATTACGCTGGTCACCCAGACGGGGATCGAGACCGTCCATTCC
GACATCGCCATGATCGCGGGCTACATGACCCTGATGGTGCCCTTCGCCGCTGGCGCGCTCGGCCGCGGCG
CCATGGCGTTCGCGGGGCTGAGCCAGAGCTTCTTGCACCCAGCGCAGATGGCGGCGCAGTCCGCCGCTCG
CGAAACCTCCACCGGCAATATGAGCCTCGGCAATACGAGCTTCGACACCCACCGGTTCAACTCCGTGGAC
GGGAACCGGCTGGCGACGTCGAGCTTCGTTGATACGGGCGAGGGGAGCTGGAACACCCCCGAAGGCGGCC
GTATGCGGATGACTGCTGGCGGGGCGCGGGTCTATGACGGCATGGGTGCCATCTCCCGCGGCGCGACCCA
TGTCGACTACCAGGGCGGTCTCTCGACGGCGCTTCAATCCGAGGCGAGCTGGTCCCTCGAGCAGCGGGAC
GCCGCCGCCAACCGCTCGAGCGAGGCCCGCACGGCACTCGCCCATAACGTCGCCGACCTCACCTGGCAGA
TGAACGAGGGACGGAGTTTCGAGGACGTGACCGGTTATGGTCAGGACACCCGCATGGCGGAATCGGCGAG
CAAGCTCCTCACCAATGCCAGCCGGTTCGCCGAGCGCTTCGCCGAAGGCAAGGACACGCGCATGGCCATA
GAGGCCTATATCGCGGCATCCGCAAGCAAGGGGGTGACCGTCCCGCTTCTTGGTTCGGCCAAAGTCGAGG
CGGGCGGGAAGGCCTCCGCCGCCTGGGAAGCGCGCCGTTCGGAAATCTACGAGGCCGCGCGGGAAGCCGT
CCGCACCGATGGCAGTCAGGACACATACGACGATGTGGTCTCGACCTTCGAGCGGGGCTCTTCCTCCGAA
AGCGGGCAGGAGACCAATGCCTGGCGGGAAGCCTTCGCCGCAAACCTCCAGGAGTCCCAGACCGCCAGCC
GCGACCTCGAACACTACCAGGCCAGATCCGATGCCGCCCGAAACCTCGCAAGCCATATCGAACGCGAAGG
CTCCGGCTTCACCGCGAATTGGGACAATGCCTTCCTCAACCACATGGCCACCCAGGAGCGTGGCGACGGA
CATGTCATCGGCGTCAACGAAGCCGCCCGGCGCTGGACCAGCGGCGACCTCGCCGATCGCATGTGGGTGG
AGGCCGAGGCAAGAAACTTCATTGAGGATCAGGCAGCCCATCTTCTCGATCGGCCGGAACTCGGAGGTTT
CCGCATGCCGGAGGGTCCCGGTGGAAGCCCCTCAGACTTTGAAGCAATCGATCAGGTGGGGGCTGAGTAT
CGATCCGACGCGGAGGCACAATCGGACGTCACTTTCAACGCCGCTCGAGCGGAGCAAATCGAAGGCACTG
CCTACTGGACGGGCCAACGTCACGAGCAGAGCGTTGCGGCCATGCGGGGTGATGACGAAGAATTGGCGCG
GTTGCGCAAACTGACGGTCCAGTCCCGCGTTCAGGACAGCCGTGATGCCGAGTGGGACGAGTTCGCGCGG
CAGGATCCCGACGAGATGTCGGAGGACGAGGCGAATATCTGGCGGAAGGCGAAGCGGTCTCCGGGGGTGG
GAAGTACGCCGGTGGATGGAGAGCAGCAGCGGTCAGATGAAGAACGAATGCCCGATTTTCAACCCTTCGG
TCAGATTGAACATTTCAAGACGGGCGCCGACCGTCTCACGGCTGACTAA
 Primer design