SecReT4
Protein ID: 304319707
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00642
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]31524..32942 [-]
Productprotein TraH
Component typeTraH_F
UniProt IDE0TB00
KEGG IDpbr:PB2503_00642
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.6e-118, Aligned region: 32..389
Protein Sequence: 472 a.a.     [Download]
>gi|304319707|ref|YP_003853350.1| protein TraH [Parvularcula bermudensis HTCC2503]
MRRFLKLPAAVASFVYGLSMPTSAAADVNAEMNQFWNDLGVAANVTGPSSFEGQRAGYYTFGNVYVRTPQ
RSLSPVNIQMPGYRAGCGGIDIYGGGFSYVNSAELVAFMKSVANNAASFAFQVALETISPVIAEKVGELQ
SVAQRINQMAINSCESGQLAVAAVWPQSDQASRVICEASASRRGLYPDWVAARHGCGSEGERSNVLAGAS
VEEKASIPQNINIAWDALKKHPVISGDRELMQFLMTLSGTEILTAGADDDAAQSYQFLPSKMLDPGVISA
FLDGGTIDIYECETDPDDLCLAPTTGGSVTIASSDGLRARVSQMLADIMGKVRTRTALTADEQAFLNVTS
LPVYKMINVHAAYEGVFADQTIQSYAEIIAIDLLYGLFEGYAEMLSEAGSTATSGARDSVVAWKEQLTRQ
REFLLQYQLENNARVEVIEQVIARTQAIERQLAGRLSKDLADAYQFSRNASY
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c32942-31524 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGCGCCGTTTCCTGAAACTGCCCGCTGCTGTCGCTTCTTTCGTGTACGGCCTCTCGATGCCCACAAGCG
CCGCCGCCGACGTCAATGCTGAGATGAACCAGTTCTGGAACGATCTCGGCGTCGCGGCCAATGTCACCGG
TCCGTCGAGCTTCGAAGGCCAGCGGGCAGGCTACTACACCTTCGGCAATGTCTATGTGCGGACGCCGCAG
CGGAGCCTGTCACCGGTCAACATCCAGATGCCCGGCTACCGGGCGGGGTGCGGCGGCATCGACATCTATG
GCGGCGGCTTCTCCTATGTGAACTCCGCCGAACTCGTCGCCTTCATGAAGTCGGTCGCGAACAATGCGGC
GAGCTTCGCCTTCCAGGTGGCGCTCGAAACCATCAGCCCCGTCATCGCGGAGAAGGTGGGCGAGCTTCAG
TCCGTCGCCCAACGGATCAATCAGATGGCGATCAATTCCTGTGAGAGCGGTCAGCTGGCCGTCGCGGCTG
TCTGGCCCCAATCGGATCAGGCGAGCCGTGTCATCTGCGAGGCGTCAGCGTCCCGTCGCGGCCTCTATCC
CGACTGGGTCGCCGCTCGCCATGGGTGCGGCTCGGAAGGCGAGCGGTCGAATGTGCTGGCCGGCGCGAGC
GTCGAGGAAAAGGCGTCGATCCCCCAGAACATCAACATCGCCTGGGATGCACTGAAGAAGCACCCCGTGA
TCTCCGGCGACCGGGAACTGATGCAGTTCCTGATGACCCTGTCGGGCACGGAGATCCTGACCGCTGGCGC
CGATGACGACGCGGCGCAAAGCTATCAGTTCTTGCCGTCCAAAATGCTCGATCCGGGGGTCATCTCCGCT
TTCCTCGATGGCGGCACCATCGATATCTATGAATGCGAAACGGACCCGGACGATCTCTGTCTCGCGCCGA
CGACCGGCGGCAGTGTGACCATCGCTTCAAGTGACGGACTTAGAGCCCGGGTCAGCCAGATGCTGGCCGA
CATCATGGGCAAGGTCCGGACCCGGACGGCCCTCACGGCGGATGAGCAGGCCTTTCTCAATGTGACGAGC
CTGCCGGTCTACAAGATGATCAACGTCCATGCCGCCTATGAAGGCGTCTTCGCCGATCAGACCATTCAGT
CCTATGCGGAGATCATCGCTATCGATCTCCTCTACGGCCTCTTCGAAGGCTATGCCGAAATGCTCAGCGA
GGCGGGCTCGACGGCGACGTCGGGCGCCAGGGACAGCGTGGTCGCCTGGAAGGAGCAGCTGACCCGCCAG
CGCGAATTCCTGCTCCAGTATCAGCTCGAGAACAATGCGCGCGTCGAGGTCATCGAACAGGTGATCGCCA
GAACCCAGGCGATCGAGCGTCAGCTCGCCGGGCGGCTCTCCAAGGATCTCGCTGACGCGTATCAGTTCTC
GCGGAACGCGAGCTATTAG
 Primer design