SecReT4
Protein ID: 304319709
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00652
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]33235..34020 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDE0TB02
KEGG IDpbr:PB2503_00652
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 8.5e-67, Aligned region: 37..250
Protein Sequence: 261 a.a.     [Download]
>gi|304319709|ref|YP_003853352.1| hypothetical protein PB2503_00652 [Parvularcula bermudensis HTCC2503]
MPLRARPIAEAALAAALLLASAVAQEDPLYCAERQLGRYFYCERPEEPERATPDAPAAPVSAIEEMAGVR
ERLEELRAEAVLRPTEAAVRDYIVYQREQLDRASTFSDVWRRLLWTDPSLDYNLLRPVSGIAKQAWLDGR
KEDRRATLAHLRDRYGLFYFYAASCSACTEFSPILRAFADTHHLTVKAVSFDGGPNPSFPDAVIDRGQME
RLGLAGSPTPALVLFDTETRAVTPVAFGIVSHAELEDRIFVLTQKEMGQDY
 
Nucleotide Sequence: 786 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c34020-33235 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGCCTTTGCGTGCCCGCCCAATTGCTGAGGCGGCGCTGGCCGCCGCTTTGTTGCTTGCGTCCGCCGTAG
CGCAGGAGGATCCGCTCTATTGCGCAGAGCGCCAGCTGGGTCGTTATTTCTACTGTGAGCGGCCCGAGGA
ACCCGAGCGCGCCACACCTGATGCACCGGCGGCACCCGTCTCGGCGATCGAGGAAATGGCGGGCGTGCGG
GAGCGGCTCGAGGAACTGCGCGCCGAAGCGGTGCTGCGTCCCACCGAAGCGGCCGTCCGCGACTATATCG
TCTATCAGCGCGAGCAGCTCGACCGGGCGAGCACCTTTTCGGACGTCTGGCGGCGGCTCCTCTGGACCGA
TCCCAGCCTCGACTACAATCTCCTGAGGCCTGTCAGCGGTATCGCCAAGCAGGCCTGGCTCGATGGGCGG
AAGGAAGATCGTCGGGCAACCCTCGCCCATCTCAGGGACCGCTACGGGCTGTTTTATTTCTACGCGGCGA
GCTGTTCGGCGTGCACGGAGTTCTCGCCCATCCTGCGCGCCTTTGCCGATACCCATCACCTGACGGTGAA
GGCCGTCAGCTTCGATGGGGGGCCGAACCCGTCCTTCCCCGACGCTGTGATCGATCGGGGGCAGATGGAG
CGGCTCGGTCTGGCAGGCTCGCCGACGCCCGCCCTTGTGCTCTTCGACACCGAGACGAGGGCCGTGACGC
CGGTCGCCTTCGGGATCGTGTCCCATGCTGAGCTCGAAGACCGGATCTTCGTCCTCACCCAGAAAGAGAT
GGGGCAGGACTATTGA
 Primer design