SecReT4
Protein ID: 304319710
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00657
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]33992..35809 [-]
Producthypothetical protein
Component typeTraN_F
UniProt IDE0TB03
KEGG IDpbr:PB2503_00657
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.4e-59, Aligned region: 312..554
Protein Sequence: 605 a.a.     [Download]
>gi|304319710|ref|YP_003853353.1| hypothetical protein PB2503_00657 [Parvularcula bermudensis HTCC2503]
MSVYLCPLGLCCLSTIAAGITLWLQAFPKWPATAAFAKIMIGVAGAILFFVVPATVSAQDMTRDEARAEA
EDLAAGLEGEVKASATQTVDADSVPSFVTGDPAETGHYSNPEGLESAGLSSLAIHEEGQVVSTAIVSRPV
VTLAELATWTANGLAIEGDATSIVSEYSGTYGDCTVTVSGGTGGARYRYSCNSGETLLSFEDRCRVPLDV
TVPSRHEFECLWTFLDGDLSWEPEPFCATLGSEASCGPLAFHGGGDCLPDWKTGVTICTPRRFRTTCDID
LIDGRSPVRTVPGTPVEAWNTAACDANTADPNCTLLGETCVEGPETRAIGGVDITRDCWAYERTYTCSSL
GGEVTDCDVPAGCILEGSTCLSTDDLTGECRATEYQYVCETAGAPGGAVGYCEEDVYCIDGDCETLTRPQ
NDEFPEAVSALSMMGQLQDDVDDATLTIFPGEYHKCDKAIAGLQNCCRDDGFLTDIGFDCSADDRALANK
QSAGLCHYVGTYCSDRTLFGICLKKRKTFCCFNNVLARLIHEQGRPQVGWDWGSTKTPDCSGYTVALFQS
LDLSLMDFSEFYDGVLDTFVGPDTDATSAAITTRIIDAFACPPNC
 
Nucleotide Sequence: 1818 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c35809-33992 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGAGCGTCTATCTCTGCCCCTTGGGTCTTTGCTGCCTGTCGACGATTGCGGCAGGCATAACGCTCTGGC
TTCAGGCCTTTCCCAAATGGCCGGCGACGGCGGCCTTCGCCAAGATCATGATCGGCGTCGCCGGGGCCAT
CCTATTTTTTGTCGTGCCCGCCACGGTCAGCGCCCAGGACATGACCCGCGACGAGGCCAGGGCGGAAGCC
GAAGACCTCGCGGCGGGTCTCGAAGGAGAGGTAAAAGCCAGCGCCACGCAAACGGTCGATGCGGACAGTG
TGCCGAGCTTTGTCACGGGCGATCCGGCGGAGACGGGCCACTATTCCAACCCCGAAGGTCTCGAATCCGC
CGGGCTCAGCTCCCTCGCGATTCATGAGGAGGGTCAGGTCGTCAGCACGGCGATCGTCTCCCGTCCGGTG
GTGACCCTGGCGGAGCTTGCCACCTGGACGGCCAACGGACTCGCCATCGAAGGCGATGCGACCAGCATTG
TGTCGGAATATTCCGGCACCTATGGCGACTGCACGGTGACCGTCTCGGGCGGGACCGGCGGGGCGCGCTA
CCGTTACAGCTGCAATTCCGGTGAGACGCTTCTGAGCTTTGAAGATCGCTGCCGGGTCCCGCTCGACGTC
ACGGTTCCGAGCCGCCATGAATTCGAATGCTTGTGGACGTTCCTGGACGGCGACCTCTCTTGGGAGCCTG
AGCCCTTCTGCGCAACCCTCGGCAGTGAGGCGTCCTGCGGCCCGCTCGCCTTTCACGGGGGCGGCGATTG
CCTCCCGGACTGGAAGACGGGCGTCACGATCTGCACACCGCGCCGCTTCCGTACGACCTGCGACATCGAT
CTGATCGACGGCCGGTCGCCTGTTCGCACAGTGCCAGGCACGCCCGTCGAGGCGTGGAACACAGCTGCCT
GCGACGCGAACACGGCCGACCCGAACTGCACGCTTCTCGGCGAGACCTGCGTGGAGGGACCCGAGACCCG
GGCGATCGGCGGCGTCGACATCACCCGCGACTGCTGGGCTTATGAACGAACCTATACCTGTTCGAGCCTG
GGCGGCGAGGTGACCGATTGCGATGTGCCGGCGGGCTGCATCCTCGAGGGGTCAACCTGTCTCTCCACGG
ACGACCTGACCGGAGAGTGCCGGGCCACTGAGTATCAATATGTCTGCGAGACGGCGGGCGCACCGGGCGG
GGCGGTCGGCTATTGCGAAGAGGATGTCTATTGCATCGATGGGGATTGCGAGACCCTGACCCGTCCGCAG
AATGACGAGTTCCCCGAAGCCGTCTCTGCGCTCTCGATGATGGGTCAGCTTCAGGATGATGTCGATGACG
CCACCCTCACCATCTTTCCCGGTGAGTACCACAAATGCGACAAGGCCATCGCCGGGCTCCAGAATTGTTG
CCGAGATGACGGGTTCCTGACCGATATCGGCTTCGACTGCTCCGCCGATGATCGGGCGCTCGCCAACAAG
CAATCCGCCGGCCTTTGCCACTATGTTGGCACCTATTGCAGCGACCGGACGCTGTTCGGGATCTGCCTCA
AAAAGCGCAAGACCTTCTGCTGCTTCAACAATGTCCTTGCCCGTCTCATTCACGAGCAGGGACGGCCGCA
GGTCGGATGGGATTGGGGCAGCACCAAGACGCCCGACTGCTCCGGCTACACCGTCGCCCTGTTCCAATCC
CTGGATCTCAGCCTCATGGACTTCTCCGAATTCTATGACGGCGTTCTCGATACCTTTGTCGGGCCGGACA
CGGACGCCACCTCTGCTGCCATCACTACACGGATCATCGATGCCTTTGCGTGCCCGCCCAATTGCTGA
 Primer design