SecReT4
Protein ID: 304319711
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00662
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]35806..36531 [-]
Producthypothetical protein
Component typeTrbC_F
UniProt IDE0TB04
KEGG IDpbr:PB2503_00662
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 4.2e-30, Aligned region: 104..219
Protein Sequence: 241 a.a.     [Download]
>gi|304319711|ref|YP_003853354.1| hypothetical protein PB2503_00662 [Parvularcula bermudensis HTCC2503]
MAILCASLMSVAPGQAQDGIDRKAIEEAVRNAEAEAAAFAAEVAARAEAYAEEARALTETVHGRWGEAAA
PSDTTEPVDLDAMVADAGVVSAARQETSGPAGVLVFVSFSMPEQSLRQLVLDAHKAQVPVLLQGFVGGSL
KETATRMRALLGADTGQDLLGGVVIDPRAFRIFRVTEVPAFIATRAPLPDCDGLDCDAPPPPHDRIAGNM
SLGAALSALASEGTDAALQARASLKRWEAQP
 
Nucleotide Sequence: 726 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c36531-35806 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGGCCATCCTCTGCGCCTCGCTGATGTCCGTGGCTCCGGGTCAGGCGCAGGATGGGATCGATCGGAAGG
CGATCGAGGAGGCAGTTCGCAACGCTGAAGCCGAAGCGGCGGCCTTCGCCGCTGAAGTCGCCGCTCGGGC
CGAGGCCTATGCCGAGGAGGCGAGGGCGCTCACCGAGACCGTCCACGGACGATGGGGCGAGGCGGCTGCG
CCCAGTGACACGACAGAGCCGGTAGACCTCGACGCAATGGTGGCCGATGCCGGTGTGGTCAGTGCCGCGC
GGCAGGAGACGTCAGGCCCTGCTGGCGTCCTCGTTTTCGTCAGTTTTTCGATGCCCGAGCAAAGTCTCCG
CCAGCTGGTGCTCGACGCGCACAAGGCCCAGGTGCCGGTGCTGCTTCAGGGCTTCGTGGGCGGCTCCCTC
AAGGAGACCGCCACCCGCATGCGAGCACTGCTCGGGGCCGACACAGGACAGGATCTTCTCGGCGGGGTTG
TGATCGATCCGCGGGCCTTCCGGATCTTCCGGGTGACCGAAGTCCCGGCCTTCATCGCGACGAGGGCGCC
ACTCCCCGACTGCGATGGTCTCGACTGCGACGCGCCTCCGCCGCCCCATGACCGGATCGCCGGCAACATG
TCACTGGGCGCGGCCCTGTCGGCGCTCGCATCCGAGGGCACCGACGCGGCGCTTCAGGCGCGTGCTTCCC
TAAAGCGATGGGAGGCACAGCCATGA
 Primer design