SecReT4
Protein ID: 304319712
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00667
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]36542..37543 [-]
Productconjugative transfer protein TraU
Component typeTraU_F
UniProt IDE0TB05
KEGG IDpbr:PB2503_00667
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5.2e-78, Aligned region: 28..332
Protein Sequence: 333 a.a.     [Download]
>gi|304319712|ref|YP_003853355.1| conjugative transfer protein TraU [Parvularcula bermudensis HTCC2503]
MRRPALILAAIAYLMTPPARADAPTCGGTFVNPITDICWSCLFPISLGAAPIWPSSRPDTANPPSPICTC
PIPLPPFVRIGLSIGYWEPVRLMDVTKKPYCFANLGGTRIDLGLSIGAKSSGQSDNEDDVGSWHVHYYMY
PLIYWLELLTDFGCMQTADFDLLYLTEIDPLWNNDELTFLLNPEAVVFANPIAQAACAADCVAASAHLPV
DQLFWCAGCHGSMYPMDGNIAAEYGHVQGASLAAERFLYKLHRQGIGWQHSGSGHVCQNWPNPMIKKSEY
RLQLVNPVPNVAGRWACPTLGASNVLYEIGRTIPVIGEDYGFLVWQKENCCVF
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c37543-36542 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGAGACGGCCGGCTCTGATCCTCGCTGCGATCGCGTACCTTATGACGCCTCCGGCGCGCGCCGATGCTC
CCACCTGCGGCGGCACCTTCGTCAATCCGATCACGGATATCTGCTGGTCGTGTCTTTTCCCGATCTCCCT
CGGTGCGGCGCCGATCTGGCCGTCCTCGCGGCCCGACACGGCCAATCCGCCGAGCCCCATCTGCACCTGT
CCGATCCCGTTGCCGCCCTTTGTCCGGATCGGGCTTTCCATCGGCTATTGGGAGCCCGTCCGACTGATGG
ACGTCACCAAAAAGCCCTATTGCTTCGCCAATCTCGGCGGCACACGGATCGACCTTGGCCTCTCCATCGG
TGCGAAGTCCTCAGGTCAGTCCGACAATGAGGACGATGTCGGCTCCTGGCACGTCCATTACTACATGTAT
CCGTTGATCTATTGGCTCGAGCTCCTGACCGATTTCGGGTGCATGCAGACGGCCGATTTCGATCTTCTCT
ATCTGACCGAGATCGATCCCCTCTGGAACAATGACGAGCTGACCTTTCTCCTCAACCCCGAAGCGGTCGT
CTTCGCCAACCCGATCGCTCAGGCGGCCTGCGCCGCCGACTGTGTCGCCGCGTCAGCCCATCTGCCGGTG
GACCAGCTCTTCTGGTGCGCGGGGTGCCATGGCTCGATGTACCCCATGGATGGCAACATCGCCGCAGAAT
ACGGCCATGTCCAAGGGGCGAGCCTCGCGGCCGAACGGTTTCTCTACAAGCTCCATCGCCAGGGGATCGG
CTGGCAGCATTCGGGCTCCGGCCATGTCTGCCAGAACTGGCCGAACCCGATGATCAAGAAGTCCGAATAC
AGACTTCAGCTGGTCAATCCTGTGCCGAACGTCGCCGGGCGGTGGGCCTGCCCCACCCTGGGCGCCTCCA
ACGTCCTCTACGAGATCGGCAGGACCATCCCGGTGATCGGAGAGGATTACGGCTTTCTCGTCTGGCAGAA
GGAGAATTGCTGTGTCTTCTGA
 Primer design