SecReT4
Protein ID: 304319713
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00672
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]37540..38157 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDE0TB06
KEGG IDpbr:PB2503_00672
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7e-11, Aligned region: 3..32
Protein Sequence: 205 a.a.     [Download]
>gi|304319713|ref|YP_003853356.1| hypothetical protein PB2503_00672 [Parvularcula bermudensis HTCC2503]
MYRAIAFAAWLALSSEATAKDLGVRGAVFPVTEPDLFAEIAGKLARLEAAGEIDRINERLRQRALASAER
PSPVPGLTRTDTPRRFHVDPTITVLDDIVTPDGQVIARAGERFNPLDYVPMRQTLLFFDGDDERQVAWAK
DRMHDGEALLSLILVAGPVLELTRDWERQIFFDQGGTLTTRFGITQVPARVSREGDLLLVEEVMP
 
Nucleotide Sequence: 618 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c38157-37540 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGTACCGCGCGATCGCGTTCGCGGCGTGGCTCGCCCTCTCTTCTGAGGCAACCGCGAAGGATCTCGGGG
TCAGGGGCGCAGTCTTCCCCGTCACCGAACCAGACCTCTTCGCCGAAATTGCCGGTAAGCTCGCGCGGCT
CGAGGCGGCGGGCGAGATCGATCGGATCAATGAGAGGCTCCGTCAGCGAGCCTTGGCTTCCGCCGAGCGA
CCGTCACCCGTGCCCGGCCTGACCCGGACGGACACCCCGCGCCGCTTCCATGTCGACCCGACGATCACGG
TGCTCGACGATATCGTCACGCCGGACGGTCAGGTGATCGCGCGGGCAGGGGAACGGTTCAATCCGCTCGA
CTATGTGCCGATGCGGCAGACGCTTCTCTTCTTCGACGGCGATGACGAGCGGCAGGTCGCCTGGGCGAAA
GATCGGATGCACGACGGAGAGGCGCTCCTCTCGCTCATCCTCGTCGCCGGACCTGTGCTCGAGCTGACCC
GGGACTGGGAACGGCAGATTTTCTTCGATCAGGGCGGGACGCTGACCACCCGTTTTGGAATCACGCAAGT
TCCCGCCCGGGTATCCCGCGAAGGCGACCTGCTCCTCGTCGAGGAGGTGATGCCATGA
 Primer design