SecReT4
Protein ID: 304319717
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00692
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]39435..42008 [-]
Productprotein TraC
Component typeTraC_F
UniProt IDE0TB10
KEGG IDpbr:PB2503_00692
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 3.1e-62, Aligned region: 32..282
AAA_10 [PF12846], Evalue: 9.9e-54, Aligned region: 481..763
TrwB_AAD_bind [PF10412], Evalue: 8.4e-09, Aligned region: 480..546
Protein Sequence: 857 a.a.     [Download]
>gi|304319717|ref|YP_003853360.1| protein TraC [Parvularcula bermudensis HTCC2503]
MTTDPLGLINRVGAALTGEGSLFDGVRRETSLDRLSEMLPYRLWDEEKALYLNAASTGWILEVVPFLGAD
ETVVSVLAEMFSDGIPDNAYLQILNWASPRIGPVLDSWATARGGEAGVFKTLALHRVDHLRRGAFRSLSA
HAPFLARQFRVFVALGVEGDASPEVRHQLEGLRSNVAQALKSLGVASRPVAPDGLIRFLDEVLNPQFAVT
RASAGYDPAELLDRQIVRPDTSLRVEADRLLFETIAPADRSPFEAPGTTQLEDYRTGRFDVRAFSARKFP
ERFDQGGMALAIGHPLNDQLRLPCPVLSCLAIAFGSKESSNDLAAAKFGRAEQQAATNMVRFLPELKDKA
DDWKWVRERVRDGARLVRAGSFLIMVAPEGEAEAAERAVRSLYRGMGWELAKDRFVATQTLGACLPLTLA
DGLGADLQKLRRLRFMVTDTCVQIAPLQGEYLGMSTPDLMLLGRRGQPFFWSPFGNQGAGNHNVAIIGSS
GSGKSVLMQELVTGLRGAGTNVTVIDDGESFKHMCEALGGRHVKFTLEADVCLNPFSLLDERKAKEDGDY
ATESLTLVRAMIEQMAKGEERATAEERGLIDSAVAEVWKARGILAGIDDVAAALKEQGAEGVKLANALRP
YTTAGLYGPFFNGEASLVIDNPLAVFEMKDLEAKPELRAVVMLALMFLINQRMMADRREKMALVIDEAWA
LLGRGAAGEFIAGFARRCRKYGGAIITGTQGIDDYYRTEGAKAAFENSDWCIVLKLKPEAIALVLKSERL
SIDAHTADIIRSLSVSAGEYSEMLIMGPHGRHVGRLVLDPFSATLFSSDARTFAEIEALEAQGLTVAEAV
ERVAFRHQDKEVRHAAE
 
Nucleotide Sequence: 2574 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c42008-39435 Parvularcula bermudensis HTCC2503 chromosome, complete genome
GTGACGACTGATCCGCTCGGTCTCATCAATCGCGTCGGTGCGGCGCTGACGGGCGAAGGCTCGCTCTTCG
ATGGCGTCCGCCGCGAGACCAGCCTCGACCGGCTCTCGGAAATGCTGCCCTACCGGCTCTGGGACGAAGA
AAAAGCGCTCTACCTCAATGCCGCGTCCACGGGCTGGATCCTGGAGGTCGTTCCATTCTTAGGCGCCGAC
GAGACGGTGGTCTCGGTGCTGGCCGAGATGTTCTCCGACGGCATTCCGGACAATGCCTATCTTCAGATCC
TGAACTGGGCGAGCCCGCGGATCGGACCTGTCCTCGATAGCTGGGCGACAGCAAGGGGCGGCGAGGCGGG
CGTCTTCAAGACGCTGGCCCTCCACCGGGTCGATCATCTGCGCCGCGGCGCCTTCCGCTCCTTGTCCGCC
CACGCCCCCTTCCTCGCACGGCAGTTCCGGGTGTTCGTCGCCTTGGGCGTGGAGGGCGATGCGTCACCGG
AGGTGCGCCACCAGCTCGAGGGGCTTAGGAGCAATGTCGCCCAGGCCCTCAAATCCTTGGGCGTCGCATC
ACGGCCTGTCGCACCGGACGGTCTGATCCGGTTTCTCGACGAGGTCCTCAACCCGCAATTCGCGGTGACG
CGGGCAAGCGCTGGCTACGATCCGGCCGAGCTCCTCGACCGGCAGATCGTCAGGCCCGACACGAGCCTCC
GGGTGGAGGCCGACCGCCTCCTCTTCGAGACCATCGCGCCGGCCGACCGGTCCCCCTTCGAAGCGCCAGG
CACCACCCAGCTCGAGGACTACCGAACCGGGCGCTTCGATGTGCGGGCCTTTTCGGCGCGGAAGTTTCCA
GAGCGCTTCGACCAGGGCGGGATGGCCCTTGCCATCGGCCATCCGCTCAATGATCAATTGCGGCTTCCCT
GTCCGGTGCTCTCCTGCCTCGCTATCGCGTTCGGGTCGAAGGAGAGCTCGAACGATCTCGCGGCGGCGAA
GTTCGGGCGGGCGGAGCAGCAGGCCGCGACCAATATGGTCCGCTTCCTGCCCGAGCTCAAAGACAAGGCT
GACGACTGGAAATGGGTCCGCGAGCGGGTGCGCGATGGCGCAAGGCTCGTGCGCGCCGGATCTTTCCTGA
TCATGGTGGCACCCGAAGGCGAGGCCGAAGCCGCCGAGCGGGCCGTCCGCTCCCTCTATCGCGGTATGGG
GTGGGAACTCGCCAAGGACCGGTTCGTCGCCACCCAGACCCTGGGCGCCTGTCTGCCCCTGACCCTAGCC
GACGGGCTCGGCGCGGACCTTCAGAAGCTTCGGCGTCTTCGCTTCATGGTCACCGACACCTGCGTCCAGA
TTGCGCCGCTCCAGGGCGAATATCTCGGTATGTCCACCCCGGACCTCATGCTTCTGGGGCGGCGGGGCCA
GCCCTTCTTCTGGTCGCCCTTCGGCAATCAGGGGGCGGGCAACCACAATGTCGCGATCATCGGATCCTCC
GGGTCCGGCAAATCGGTCCTGATGCAGGAACTGGTGACCGGGCTGAGAGGCGCAGGAACCAATGTCACCG
TCATCGACGATGGCGAGAGCTTCAAGCATATGTGCGAGGCCCTTGGCGGACGGCATGTGAAGTTCACCCT
CGAGGCTGATGTCTGCCTCAACCCATTCTCGCTGCTCGACGAGCGAAAGGCGAAGGAAGACGGCGACTAC
GCCACCGAGAGCCTGACCCTCGTTCGCGCCATGATCGAACAGATGGCCAAGGGCGAGGAGCGCGCCACGG
CCGAAGAGCGGGGTCTCATCGACAGTGCCGTGGCCGAGGTCTGGAAGGCGAGGGGCATCCTCGCCGGGAT
CGACGATGTCGCCGCGGCACTGAAGGAGCAGGGCGCCGAAGGGGTGAAGCTTGCCAACGCCCTTCGTCCT
TACACGACGGCCGGGCTCTACGGCCCCTTTTTCAACGGCGAGGCGAGCCTCGTCATCGACAACCCGCTGG
CGGTTTTCGAGATGAAGGATCTCGAGGCCAAGCCCGAACTGCGCGCCGTTGTCATGCTGGCGCTCATGTT
CCTGATCAATCAGCGCATGATGGCGGATCGGCGCGAGAAGATGGCGCTGGTGATCGACGAGGCCTGGGCG
CTTCTCGGGCGCGGGGCTGCCGGAGAGTTCATCGCGGGGTTCGCCCGTCGCTGCCGCAAATATGGCGGCG
CCATCATCACCGGCACCCAAGGGATCGACGACTATTACCGCACCGAAGGGGCCAAGGCAGCCTTTGAGAA
CTCCGACTGGTGCATCGTCCTCAAACTGAAACCCGAGGCGATTGCTCTGGTCCTCAAATCCGAGCGCCTG
TCGATCGACGCGCACACCGCCGACATCATCCGCTCCCTGTCGGTTTCCGCAGGCGAATATTCCGAAATGC
TGATCATGGGACCCCATGGCCGCCATGTGGGCCGGCTGGTGCTCGATCCCTTCTCGGCGACCCTTTTCTC
GTCCGATGCCCGGACCTTTGCCGAGATCGAGGCGCTGGAAGCCCAGGGTCTCACAGTAGCGGAGGCCGTC
GAGCGCGTCGCCTTCCGCCATCAAGACAAGGAGGTGCGCCATGCCGCGGAGTGA
 Primer design