SecReT4
Protein ID: 304319718
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00697
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]41998..42459 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDE0TB11
KEGG IDpbr:PB2503_00697
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 6.4e-12, Aligned region: 63..117
Protein Sequence: 153 a.a.     [Download]
>gi|304319718|ref|YP_003853361.1| hypothetical protein PB2503_00697 [Parvularcula bermudensis HTCC2503]
MTRALIIPLFALAVTGCSSTMRLENVAGTWSCPRVDGVCADIAAIDRSVVGETGPLPIRGPATPSSPLVT
VGLEEDGMALTRTGDEVARIVLAPMIDAHGHYHASRVIYAVMSTGGWARTPVARPEATSIAATAPLPTEP
RTRLASEGGDRDD
 
Nucleotide Sequence: 462 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c42459-41998 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGACCCGTGCCCTGATCATCCCGCTTTTCGCTCTCGCTGTGACAGGCTGTTCCAGCACCATGCGCCTCG
AGAATGTTGCCGGCACGTGGAGCTGTCCGCGGGTCGATGGCGTCTGCGCCGACATTGCCGCGATCGACCG
CAGCGTAGTTGGCGAGACCGGGCCGTTGCCGATCCGTGGCCCCGCCACACCGTCCTCACCCCTCGTCACC
GTCGGCCTGGAAGAGGACGGCATGGCCCTGACCCGCACCGGGGATGAGGTGGCGCGGATCGTCCTGGCGC
CGATGATCGACGCCCATGGCCACTATCATGCGAGCCGTGTGATCTATGCCGTCATGAGCACGGGGGGATG
GGCGCGCACGCCGGTCGCCAGGCCGGAGGCCACCTCCATTGCTGCGACCGCGCCGCTGCCGACGGAGCCG
CGCACGCGGCTCGCCTCCGAAGGAGGGGATCGTGACGACTGA
 Primer design