SecReT4
Protein ID: 304319720
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00707
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]43444..44700 [-]
Productconjugative transfer factor, TraB
Component typeTraB_F
UniProt IDE0TB13
KEGG IDpbr:PB2503_00707
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.4e-36, Aligned region: 205..413
Protein Sequence: 418 a.a.     [Download]
>gi|304319720|ref|YP_003853363.1| conjugative transfer factor, TraB [Parvularcula bermudensis HTCC2503]
MSEENKKRLTRQRLLMYGAGAAAVAAASVWIFSGDGADNQTRAEDLRRRKAMTDVINPPGMADDFLSETG
TRLAAVEGAISRLEADNTSLKEALRSRDLELAATRADLQKTRDDAAAMVEDMAGRVASVSTRTEPALGLP
TSEPSAIGDPFGRRGVLPSGAAPQPLSVEPVIPRTVQVLQFAAATEALDTRVLEPAVFRLDEGDYVPPNA
YAPAHVLVGVDMSTGVRLSADPKPVLLRITGPARSVLQNGRQLDVDLTGCLVNGAAHAELSSERVYVKLQ
KITCDRGDGEVAESPVEGYIAQLGKVGVRGRVVSREGDIVSKALVAGVVGGFGRGIARNTDQIFAAGTAG
GSTIIGQDNLSAGEIAAGGFGEGLATAADTVSDYLIDRAEQYQPVIEMPTGIDVEIVFLSGFYARGTQ
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c44700-43444 Parvularcula bermudensis HTCC2503 chromosome, complete genome
GTGAGCGAGGAGAACAAGAAGCGCCTCACCCGGCAACGGCTCCTGATGTACGGCGCCGGCGCGGCCGCCG
TCGCGGCGGCCAGCGTCTGGATCTTCTCCGGCGACGGGGCCGATAATCAAACCCGTGCGGAGGATCTACG
GCGGCGCAAGGCGATGACCGACGTCATCAACCCGCCTGGCATGGCGGACGATTTTCTTTCCGAAACCGGG
ACAAGGCTTGCCGCCGTGGAGGGCGCCATCTCCCGGCTCGAGGCCGACAACACATCCCTCAAGGAGGCCC
TGCGCTCCCGCGACCTCGAACTCGCCGCGACCCGCGCCGACCTCCAGAAGACCCGCGACGATGCCGCCGC
CATGGTGGAGGACATGGCGGGCCGCGTTGCCTCGGTCAGCACCCGCACCGAACCCGCCTTGGGGTTGCCG
ACGTCCGAACCCTCTGCCATCGGCGATCCCTTCGGGCGGCGGGGCGTCCTGCCTTCGGGCGCGGCGCCCC
AACCCTTGAGCGTCGAGCCGGTCATCCCGCGGACCGTGCAGGTCCTGCAGTTCGCGGCGGCGACGGAAGC
CCTCGACACACGGGTCCTCGAGCCCGCGGTGTTCCGGCTCGATGAGGGCGATTACGTCCCGCCCAACGCC
TATGCCCCGGCACATGTGCTGGTGGGCGTCGACATGTCGACCGGCGTCCGTCTTTCCGCCGATCCCAAAC
CCGTCCTTTTACGGATTACCGGGCCAGCGCGGTCTGTGCTGCAGAACGGACGCCAACTGGACGTCGATCT
CACCGGCTGTCTCGTCAATGGGGCGGCCCATGCGGAGCTGTCCTCCGAGCGGGTCTATGTGAAGCTCCAG
AAGATCACCTGTGACCGGGGTGACGGCGAAGTCGCCGAGAGCCCGGTCGAAGGGTACATTGCCCAGCTTG
GCAAGGTTGGGGTCAGGGGCCGGGTGGTCTCGCGGGAAGGGGACATCGTCTCCAAGGCGCTCGTGGCTGG
CGTCGTTGGCGGGTTTGGCCGCGGCATCGCGCGCAACACGGATCAGATCTTCGCGGCGGGCACCGCGGGC
GGATCGACCATCATCGGTCAGGACAATCTGTCGGCCGGGGAGATCGCCGCGGGCGGCTTTGGCGAAGGGC
TCGCCACGGCAGCCGACACGGTCTCCGACTACCTCATCGATCGCGCCGAGCAGTACCAGCCGGTGATCGA
GATGCCGACCGGCATCGATGTCGAGATCGTCTTCCTGTCCGGCTTCTATGCGCGAGGGACGCAATGA
 Primer design