SecReT4
Protein ID: 304319721
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00712
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]44697..45428 [-]
Producthypothetical protein
Component typeTraK_F
UniProt IDE0TB14
KEGG IDpbr:PB2503_00712
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.4e-49, Aligned region: 1..236
Protein Sequence: 243 a.a.     [Download]
>gi|304319721|ref|YP_003853364.1| hypothetical protein PB2503_00712 [Parvularcula bermudensis HTCC2503]
MIRTLLISAASAACLSAAAHAQQIVEASDGGVVTGYVSASGITRLRFTSDAAASVQMAEGGEGAGFSIQH
EPATGDLYLTLGRLPRQGEAVGAASFFVTTRAGYTYQVELAAKATPSTQIEVRNPDLARRQTERALAETS
LDEEVVALTRAMWASALLDGYEIKRPVVRERAAGTLRLAVRATYESDALQGRVLIARNPSRGDVAIEESL
FLAPGVAAVTIQGPRVLGPGASVPVLIVDRGQP
 
Nucleotide Sequence: 732 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c45428-44697 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGATTCGGACCCTCCTTATCTCCGCCGCCAGTGCGGCCTGTCTTAGCGCGGCGGCCCATGCCCAACAAA
TCGTCGAAGCCTCCGATGGCGGTGTCGTCACCGGCTATGTGAGCGCCAGTGGGATCACGCGGCTGCGCTT
TACGAGCGATGCCGCGGCGTCGGTCCAGATGGCCGAAGGCGGAGAGGGGGCCGGGTTCTCGATCCAGCAC
GAGCCCGCCACGGGGGATCTCTATCTGACCCTCGGTCGGCTGCCCCGCCAGGGCGAGGCCGTCGGCGCGG
CGAGCTTCTTCGTCACAACGCGGGCAGGATACACTTATCAGGTCGAGCTTGCGGCCAAGGCGACGCCGTC
CACCCAGATCGAGGTGCGAAACCCTGACCTTGCCCGCCGCCAGACGGAACGGGCGCTTGCCGAAACGTCG
CTCGATGAGGAAGTCGTCGCCCTGACCCGCGCCATGTGGGCCAGTGCATTGCTCGACGGCTATGAGATCA
AGCGGCCGGTTGTTCGCGAGCGGGCCGCCGGGACGCTGCGCCTCGCGGTCCGGGCAACCTATGAAAGCGA
CGCGCTTCAGGGACGTGTGCTGATTGCCCGCAATCCGAGCCGCGGTGACGTGGCGATCGAGGAAAGCCTG
TTCCTGGCGCCGGGCGTTGCGGCGGTGACCATCCAAGGACCGCGTGTTCTCGGTCCCGGCGCATCCGTCC
CCGTCCTCATCGTCGATCGGGGGCAGCCGTGA
 Primer design