SecReT4
Protein ID: 304319722
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00717
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]45425..46024 [-]
Producthypothetical protein
Component typeTraE_F
UniProt IDE0TB15
KEGG IDpbr:PB2503_00717
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.6e-58, Aligned region: 1..183
Protein Sequence: 199 a.a.     [Download]
>gi|304319722|ref|YP_003853365.1| hypothetical protein PB2503_00717 [Parvularcula bermudensis HTCC2503]
MDTNVSYTRLKTALRQRNVLAVFTLLLGVTGLLQTYLIATRDRHVILTPTLLSDTAISARAPSPEYLEQV
TRDVAGLFLNRHPHNLSYFRENILRLAHPSTHGEIESALMETERRLIATKTATVFYPAEIYVDPLTLYSE
IRGELHTYLGPERVSSDPALYAADWRFEAMRLWLEDFYPITADEARAPKAPLIKAETTR
 
Nucleotide Sequence: 600 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c46024-45425 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGGACACGAACGTCTCCTATACCCGCCTCAAGACGGCCCTCCGCCAACGGAACGTCCTGGCTGTCTTCA
CGCTGCTCCTCGGCGTCACCGGCCTTCTTCAGACCTATCTCATCGCGACGCGCGACCGGCATGTCATCCT
GACGCCGACGCTGCTGTCCGATACGGCGATCAGCGCCCGTGCACCGTCGCCTGAATATCTTGAACAGGTG
ACCCGCGACGTGGCCGGGCTGTTCCTCAACCGGCACCCCCATAATCTCTCCTACTTCAGAGAGAACATTC
TCCGCCTCGCGCACCCCTCGACCCATGGCGAGATCGAGTCGGCGCTGATGGAGACCGAACGGCGACTGAT
CGCCACCAAGACGGCGACGGTCTTCTATCCGGCGGAGATCTATGTCGATCCGCTGACGCTCTATTCCGAA
ATCCGCGGCGAGCTTCACACCTATCTGGGCCCCGAGCGGGTCTCCTCCGATCCCGCGCTTTATGCCGCCG
ACTGGCGTTTCGAGGCCATGCGGCTCTGGCTCGAGGATTTCTATCCCATCACGGCCGACGAGGCGCGCGC
GCCCAAGGCGCCGCTTATCAAAGCGGAGACGACGCGATGA
 Primer design