SecReT4
Protein ID: 304319723
T4SS name [ID]Tra_F [547]
Gene symbol-
Locus tagPB2503_00722
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]46027..46320 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDE0TB16
KEGG IDpbr:PB2503_00722
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.2e-29, Aligned region: 6..96
Protein Sequence: 97 a.a.     [Download]
>gi|304319723|ref|YP_003853366.1| hypothetical protein PB2503_00722 [Parvularcula bermudensis HTCC2503]
MAQTDRTRIPATLDEPEKLAFWTIDEFIVLIGGFMLGIVLSRFVEGILAGFVGVWALKKFKKGESLNLLR
YAAYWVLPSSLFAFKRTLSSYKRDLAG
 
Nucleotide Sequence: 294 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c46320-46027 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGGCGCAGACGGACAGAACCCGTATCCCGGCGACCCTCGACGAGCCTGAAAAGCTCGCCTTCTGGACGA
TCGACGAATTTATCGTCCTGATCGGCGGCTTCATGCTCGGGATCGTCCTGTCGCGCTTCGTCGAAGGGAT
CCTCGCCGGCTTTGTCGGTGTCTGGGCGCTCAAGAAGTTCAAGAAGGGCGAGAGCCTCAACCTCTTACGA
TACGCTGCCTATTGGGTGCTGCCCTCAAGCCTCTTCGCCTTCAAGCGGACCTTGTCCTCCTACAAGCGGG
ACCTGGCGGGCTGA
 Primer design