SecReT4
Protein ID: 304320288
T4SS name [ID]Trb [353]
Gene symbol-
Locus tagPB2503_03572
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]646397..647395 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDE0TDN4
KEGG IDpbr:PB2503_03572
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-69, Aligned region: 100..321
Protein Sequence: 332 a.a.     [Download]
>gi|304320288|ref|YP_003853931.1| conjugal transfer protein TrbG [Parvularcula bermudensis HTCC2503]
MIRTLVIIGALVSLGACASTNPHDNFVLDDAEFMEAVYLADDPNGEPLIIERIEPLAMAGQLKPLTESPI
AAVPELKPYEAIDEANRSAAVEPDATSFINAIQIYPYTIGALYQVYTAPEQVTDIALQPGEELMSVSAGD
TVRWVLGDTVSGSGDASQTHILVKPIASGLKTNLIITTSKRTYHIEMTSYRETYMAAVSWRYPHEELVTA
RGDAARRQAQGRTVIDRGLSLDRINFRYEIKGDEPHWRPLRAFDDGRKVYIQFPSRLDQGEAPPLFVVGR
NGDSQLVNYRINGAYYIVDRLFAVAELRLGEDDQEVVRIERTAAPRNWMAGL
 
Nucleotide Sequence: 999 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c647395-646397 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGATCCGCACTCTCGTAATAATCGGCGCGCTCGTCTCATTGGGCGCCTGCGCTTCCACCAATCCCCACG
ACAACTTCGTTCTCGATGACGCCGAGTTCATGGAGGCTGTCTATCTGGCGGACGATCCGAACGGGGAACC
CCTCATCATCGAGAGGATCGAGCCGCTCGCGATGGCCGGACAACTTAAACCGCTGACGGAATCGCCAATA
GCGGCGGTCCCGGAGTTGAAACCCTATGAAGCCATCGACGAGGCGAACCGGAGCGCCGCCGTTGAACCCG
ACGCGACAAGCTTCATCAACGCCATCCAGATTTATCCCTATACGATTGGCGCGCTCTATCAGGTCTACAC
TGCCCCGGAGCAGGTGACAGACATAGCGCTCCAACCCGGCGAGGAGCTGATGTCGGTTTCCGCCGGCGAC
ACCGTGCGCTGGGTCCTGGGCGATACGGTCTCAGGCTCTGGCGACGCCAGTCAGACGCACATTCTGGTGA
AGCCAATCGCCTCCGGTCTCAAGACCAACCTCATCATCACGACCTCCAAACGAACCTACCACATCGAAAT
GACGTCCTACCGCGAAACCTATATGGCGGCGGTGTCCTGGCGTTATCCGCATGAAGAACTGGTCACGGCG
CGCGGCGACGCCGCCCGCCGGCAGGCGCAGGGGCGCACTGTCATTGATCGCGGCCTCAGCCTTGATCGCA
TCAATTTCCGTTATGAGATCAAAGGTGACGAACCCCACTGGCGTCCATTGCGCGCTTTCGATGACGGCCG
GAAAGTCTATATTCAGTTTCCGTCCCGTCTCGATCAGGGCGAAGCGCCGCCGCTCTTCGTCGTCGGGCGC
AATGGCGACAGCCAACTCGTCAATTACAGGATCAATGGCGCCTACTACATAGTCGACCGCCTGTTTGCGG
TCGCCGAACTGCGCCTCGGTGAAGACGATCAGGAGGTGGTTCGGATCGAACGCACCGCCGCTCCCAGAAA
TTGGATGGCGGGTCTATGA
 Primer design