SecReT4
Protein ID: 304320290
T4SS name [ID]Trb [353]
Gene symbol-
Locus tagPB2503_03582
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]648094..649431 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDE0TDN6
KEGG IDpbr:PB2503_03582
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.5e-49, Aligned region: 37..262
Protein Sequence: 445 a.a.     [Download]
>gi|304320290|ref|YP_003853933.1| conjugal transfer protein TrbL [Parvularcula bermudensis HTCC2503]
MEDLGIIDRFLATFSTYIDSGFGLLGPDVAYLTAFLIGIDVVLAGVFWAMGPENNIIGTFVKKVLYVGFF
ALILNNFAFLANVIFESFAQLGLNASGSTITAADLLRPGFVADTGFTAGHPLLEEIGDLTGPVGFFVNFV
TIAILFLAWLITLFAFFFLAIQLFVTVIEFKLTTLAGFVLIPFALWNKTSFLAERVLGNVISSGIKLMVL
AVIVGIGSTLFGSVTAEITPGDVTLEDAATVILASLALVALGIFGPGIAAGLVSGAPQLGAGAVVGTAAG
VGAGAIAGGALAGGALRAGAAATGGAIKAGASLSGGAATSFSLGKAASGANGWRATAAGVGAMAEAGARS
FASGARSAASRAVAPVKRSFESGGRTAFSATGGTLGDVAAAPAATGGAPNWARQVQRQQLQRDASLAAAS
ALRDGANNGSGGGSGDGPRLKQDED
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c649431-648094 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGGAAGACCTCGGCATCATCGATCGGTTTCTGGCGACCTTTTCGACCTATATCGATTCAGGTTTCGGGT
TGCTTGGTCCCGACGTCGCCTATCTGACGGCGTTCCTGATCGGCATCGATGTCGTCCTCGCCGGGGTCTT
CTGGGCGATGGGGCCGGAAAACAACATCATCGGAACCTTCGTCAAGAAGGTTCTCTATGTCGGCTTCTTC
GCCCTCATCCTCAACAATTTCGCCTTTCTCGCCAATGTCATCTTCGAGAGCTTCGCGCAGCTCGGTCTGA
ATGCGTCCGGCTCGACCATCACGGCCGCCGATCTGCTGCGCCCCGGTTTCGTCGCCGATACCGGCTTCAC
CGCCGGGCACCCCTTGCTTGAAGAGATCGGCGATCTGACAGGCCCGGTCGGTTTCTTCGTCAACTTCGTC
ACCATCGCCATTCTGTTTCTCGCCTGGCTCATCACGCTCTTCGCGTTCTTCTTTCTGGCGATCCAGCTTT
TCGTCACGGTGATCGAGTTCAAGCTGACGACGCTTGCTGGCTTCGTCCTCATTCCCTTTGCACTTTGGAA
CAAGACCTCGTTCCTGGCTGAGCGCGTTCTCGGGAATGTCATCTCATCCGGCATCAAACTCATGGTGCTG
GCGGTGATTGTCGGCATCGGCTCCACTCTCTTCGGATCTGTCACGGCGGAAATCACGCCCGGAGACGTGA
CCCTGGAAGACGCCGCCACCGTCATTCTGGCGTCGCTCGCCCTCGTCGCGCTTGGAATCTTCGGTCCTGG
CATCGCCGCCGGCCTTGTTTCCGGCGCCCCGCAACTCGGCGCCGGCGCCGTCGTCGGAACCGCCGCAGGC
GTTGGAGCGGGCGCTATCGCCGGAGGCGCGCTCGCGGGCGGCGCATTGCGCGCAGGCGCAGCAGCAACAG
GCGGCGCCATCAAAGCGGGCGCATCTCTTAGCGGCGGCGCCGCGACTTCCTTTTCCCTCGGCAAGGCCGC
TTCCGGCGCAAACGGATGGCGTGCAACCGCCGCCGGCGTCGGCGCGATGGCGGAGGCTGGCGCGAGGAGT
TTCGCAAGCGGCGCTCGCTCGGCAGCGTCGCGGGCCGTTGCGCCTGTGAAGCGGAGCTTCGAAAGCGGAG
GCCGCACAGCTTTCAGCGCCACAGGCGGAACGCTGGGTGACGTCGCCGCCGCCCCGGCCGCCACGGGCGG
AGCGCCGAATTGGGCGAGGCAGGTTCAACGTCAGCAATTGCAGAGAGACGCAAGCCTCGCAGCCGCATCG
GCCTTGCGTGACGGCGCCAATAACGGTTCTGGGGGCGGGTCGGGCGACGGTCCGCGTCTCAAACAGGATG
AGGACTGA
 Primer design