SecReT4
Protein ID: 304320294
T4SS name [ID]Trb [353]
Gene symbol-
Locus tagPB2503_03602
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]652834..653151 [-]
Productconjugal transfer protein
Component typeTrbC
UniProt IDE0TDP0
KEGG IDpbr:PB2503_03602
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.1e-23, Aligned region: 5..95
Protein Sequence: 105 a.a.     [Download]
>gi|304320294|ref|YP_003853937.1| conjugal transfer protein [Parvularcula bermudensis HTCC2503]
MTLTKHTCRALAITFGLIVLVGPAHAAGSGMPWEAPLDSILQSIEGPVAKIVGTLAIIITGLTLAFGDTG
GGFRKLIQIVFGLSIAFTATSFFLSFFSFGGGATI
 
Nucleotide Sequence: 318 bp     [Download]
>gi|304319677|ref|NC_014414.1|:c653151-652834 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGACCCTGACGAAACACACCTGCCGCGCGCTCGCAATTACGTTCGGTCTCATCGTCCTTGTTGGTCCCG
CCCATGCGGCCGGGTCCGGCATGCCCTGGGAAGCGCCCCTCGATTCCATCCTCCAGTCGATCGAGGGGCC
GGTGGCCAAGATCGTCGGCACGCTCGCCATCATCATCACCGGCCTGACGCTGGCCTTCGGCGATACGGGC
GGCGGCTTCCGCAAACTCATCCAGATCGTGTTCGGGCTCTCCATCGCGTTCACAGCGACGAGCTTCTTCC
TGTCCTTCTTCTCGTTCGGCGGCGGCGCGACGATCTGA
 Primer design