SecReT4
Protein ID: 304320711
T4SS name [ID]Trb [354]
Gene symbol-
Locus tagPB2503_05702
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]1090222..1090557 [+]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDE0TGX2
KEGG IDpbr:PB2503_05702
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.2e-24, Aligned region: 7..102
Protein Sequence: 111 a.a.     [Download]
>gi|304320711|ref|YP_003854354.1| conjugal transfer protein Trbc [Parvularcula bermudensis HTCC2503]
MTLYNHLQTVNRTVQVAACIGLGLLIAGPAHAAGSGMPWEGPLDQILTSIEGPVARIVAVIIITITGLTL
AFGETSGGMRKLIQIVFGLSIAFAATSFFLTFFSFGGGALI
 
Nucleotide Sequence: 336 bp     [Download]
>gi|304319677|ref|NC_014414.1|:1090222-1090557 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGACACTCTACAATCATCTTCAGACCGTGAACCGAACGGTTCAGGTCGCAGCCTGTATCGGCCTCGGAT
TGCTAATCGCAGGGCCAGCCCATGCGGCAGGCTCAGGCATGCCCTGGGAAGGCCCGCTCGATCAGATCCT
GACTTCGATTGAAGGCCCGGTCGCACGCATCGTAGCGGTGATCATCATTACGATTACGGGGCTCACGCTG
GCTTTTGGTGAAACCTCCGGCGGCATGCGCAAGCTGATCCAGATCGTGTTTGGGCTTTCCATCGCGTTCG
CAGCGACTTCTTTCTTCCTAACCTTCTTCTCGTTCGGCGGCGGAGCACTGATCTGA
 Primer design