SecReT4
Protein ID: 304320715
T4SS name [ID]Trb [354]
Gene symbol-
Locus tagPB2503_05722
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]1093991..1095307 [+]
Productconjugal transfer protein
Component typeTrbL
UniProt IDE0TGX6
KEGG IDpbr:PB2503_05722
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.8e-48, Aligned region: 34..260
Protein Sequence: 438 a.a.     [Download]
>gi|304320715|ref|YP_003854358.1| conjugal transfer protein [Parvularcula bermudensis HTCC2503]
MDVIDTFLATFIAYIDSGFGLLAGDVAYLSTTLIAIDITLAGLFWALSQNTDVIAGLLKKVLYVGFFAFI
IGNFSLLAGIVFDSFAELGVTAGGGTMTADDLLRPGFIARVGLEAGQPLLEEISDMLGPIFFFHNFIMIA
VMFVAWAIIMVAFFVLAVQLFITILEFKLTTLAGFVLVPFALWNKTTFLAERVLGNVITSGIKLMVLAVI
IGIGSTLFSSVTDAFRTGDDVTLAQVMGTVLAAIVFFWMGIFAPGIASGLITGAPQLGAGSAAGAAAGVA
AGTYVAGMGGRAAVGAVAGGASSAVKAGASMAGAARTSYTLGSVASGASGASGVAAGLAGVARAGGDAMR
RTASRPAQALRDAYRRGSQGAWRATGGSETATMQSSASGSSSSQSPGWARRMQTSQRMGQAGQMAAHSVR
DGDRGASGANPTLKDKDD
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|304319677|ref|NC_014414.1|:1093991-1095307 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGGACGTGATCGACACCTTCCTTGCGACCTTTATCGCATACATTGACAGCGGGTTCGGCCTGCTGGCGG
GCGATGTCGCTTATCTGTCGACCACGCTCATCGCCATCGATATAACGCTGGCGGGCCTGTTCTGGGCGCT
TTCGCAGAACACGGACGTTATCGCCGGGCTCCTGAAGAAAGTGCTCTATGTCGGCTTCTTCGCTTTCATC
ATCGGCAACTTCTCGCTGCTGGCAGGCATCGTCTTTGACAGCTTTGCCGAGCTTGGCGTGACCGCGGGCG
GCGGCACGATGACCGCCGATGACCTCCTGCGCCCCGGCTTTATTGCGCGCGTCGGCCTCGAAGCCGGTCA
GCCGCTGCTCGAAGAAATCAGCGACATGCTGGGGCCGATCTTCTTCTTCCATAACTTCATCATGATAGCG
GTCATGTTCGTGGCCTGGGCGATCATCATGGTGGCCTTCTTCGTGCTGGCCGTGCAGCTCTTTATCACCA
TTCTGGAGTTCAAGCTGACCACGCTGGCCGGATTTGTGCTCGTGCCGTTCGCGCTCTGGAACAAGACGAC
GTTTCTGGCGGAGCGCGTCCTTGGCAATGTCATCACTTCGGGCATCAAGCTCATGGTGCTCGCCGTCATC
ATCGGCATCGGCTCGACGCTCTTCTCCTCCGTCACAGACGCGTTCCGCACCGGCGATGATGTCACGCTGG
CCCAAGTCATGGGGACAGTGCTGGCTGCGATTGTCTTCTTTTGGATGGGCATCTTCGCGCCGGGCATTGC
GAGCGGCCTCATTACCGGCGCGCCGCAACTTGGCGCTGGCTCAGCCGCAGGCGCTGCCGCCGGTGTCGCT
GCCGGAACCTATGTCGCCGGGATGGGCGGGCGTGCCGCTGTCGGCGCGGTCGCGGGCGGCGCATCCTCCG
CCGTCAAGGCAGGCGCCTCCATGGCAGGCGCGGCACGCACCTCCTACACGCTCGGTTCGGTCGCCTCCGG
GGCATCGGGCGCATCCGGTGTGGCCGCAGGTCTTGCCGGTGTCGCACGCGCTGGCGGCGACGCCATGCGC
CGCACAGCCTCACGCCCGGCCCAAGCTCTCAGAGATGCCTACCGTCGTGGCAGCCAGGGCGCCTGGCGCG
CGACCGGCGGCTCTGAGACTGCCACCATGCAAAGCTCTGCGTCCGGATCCTCCTCATCGCAAAGCCCCGG
TTGGGCGCGGCGCATGCAGACCAGTCAGCGCATGGGCCAGGCCGGACAGATGGCCGCCCACTCGGTCCGC
GACGGGGATCGCGGTGCCTCCGGCGCCAACCCGACCCTCAAAGACAAGGACGACTAG
 Primer design