SecReT4
Protein ID: 304320717
T4SS name [ID]Trb [354]
Gene symbol-
Locus tagPB2503_05732
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]1096009..1097046 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDE0TGX8
KEGG IDpbr:PB2503_05732
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-71, Aligned region: 111..333
Protein Sequence: 345 a.a.     [Download]
>gi|304320717|ref|YP_003854360.1| conjugal transfer protein TrbG [Parvularcula bermudensis HTCC2503]
MLRFILATCALALTTACATTELEPIDASAFVAATPVEDEPDYPVEIVETAVALPLPGQMMPIGARVATNP
DGSVTRTYTRTASRPSVSPAEAIRQGRTSALIEPSVDGYVNAIQVYPYTEGALYRLYASPGQVSDIALQP
GEELVSVSAGDTVRWVVGDTISGSGNTARAHVLVKPISSGIRTNLMIATDRRTYHLELESTEGGYMAALS
WRYPADELAGLTARNERAIARDAGRIERGLTLEGLNFDYRLSGDSPDWKPVRVFDDGRQVFIQMPEDIAT
TDMPPLFVLGADGDAELVNYRVRGNYYVVDRLFRAAELRLGERNQTVVRISRNERRSPLAAIFGG
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|304319677|ref|NC_014414.1|:1096009-1097046 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGCTTCGCTTTATCCTCGCCACATGTGCACTCGCGCTCACCACGGCCTGCGCCACGACGGAACTTGAAC
CCATCGATGCCAGCGCCTTCGTCGCGGCAACGCCGGTCGAAGACGAGCCCGACTATCCGGTGGAGATTGT
CGAGACCGCCGTGGCGCTTCCGCTGCCCGGCCAGATGATGCCCATAGGCGCACGCGTCGCGACGAATCCC
GATGGCAGTGTGACACGAACCTACACACGCACGGCCTCACGGCCTTCAGTCTCTCCGGCGGAAGCGATCC
GACAAGGCCGCACCAGCGCGCTCATTGAGCCTTCGGTCGATGGCTATGTGAACGCGATCCAGGTCTATCC
TTATACCGAAGGCGCGCTCTACCGGCTCTATGCGAGCCCGGGACAGGTCAGTGACATAGCGCTGCAGCCA
GGCGAAGAACTGGTCTCTGTCTCTGCTGGCGATACAGTCCGCTGGGTGGTCGGCGATACGATCTCAGGCT
CCGGCAACACGGCCCGCGCGCATGTGCTGGTCAAGCCGATCTCCTCCGGCATTCGCACAAACCTGATGAT
CGCCACCGACCGGCGCACCTATCACCTCGAACTGGAAAGCACTGAGGGCGGCTACATGGCCGCGCTCTCC
TGGCGCTACCCGGCCGATGAACTGGCAGGCCTGACCGCCCGGAATGAACGCGCCATTGCGAGGGATGCAG
GCAGGATTGAGCGCGGCCTGACCCTTGAGGGCCTCAACTTCGATTACCGGCTCTCCGGTGACAGTCCGGA
CTGGAAGCCGGTGCGCGTCTTCGATGATGGCCGTCAGGTGTTCATCCAGATGCCAGAGGACATCGCGACC
ACCGACATGCCGCCGCTGTTCGTGCTGGGCGCTGACGGTGACGCGGAACTCGTCAACTATCGCGTGCGCG
GCAATTACTATGTCGTCGACCGGCTGTTCCGTGCGGCCGAGCTGCGCCTGGGCGAGCGCAACCAGACCGT
TGTGCGCATCTCCCGCAACGAGCGTCGTTCGCCTCTTGCCGCGATCTTCGGGGGCTAG
 Primer design