SecReT4
Protein ID: 304322040
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12504
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2543478..2544173 [+]
Productconjugal transfer protein
Component typeTraF
UniProt IDE0TFI1
KEGG IDpbr:PB2503_12504
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.5e-36, Aligned region: 28..164
Protein Sequence: 231 a.a.     [Download]
>gi|304322040|ref|YP_003855683.1| conjugal transfer protein [Parvularcula bermudensis HTCC2503]
MSRRIALLGMGCGLGLMVSASIINRSDFIWNRTESMPKGLYFVDRSARISTGDLVAFAPSDEVRHWLNDE
GIVGSDWPLLKHVAGLSGDEICRCDTQVSINGITSVDALKVTESGSALPVWQGCQTLKAGDVFLLNSHPL
SVDGRYFGVQDGARIIGVARSIWTYGNRSAEDQATVKAIDSGTGMASVSRRARLRECHPATLNPLSAHPF
LCDPVPEGGCTDLQSAAHLEP
 
Nucleotide Sequence: 696 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2543478-2544173 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGAGTCGTAGAATCGCGTTGTTAGGCATGGGATGCGGGCTAGGCCTCATGGTCTCCGCCAGCATTATCA
ACCGGTCCGACTTCATCTGGAACCGGACGGAAAGCATGCCCAAGGGCCTTTACTTTGTTGACCGGTCGGC
GCGAATTTCGACAGGCGATCTGGTAGCGTTTGCGCCCTCGGATGAGGTTCGACATTGGCTGAACGATGAG
GGAATTGTTGGCTCCGACTGGCCCTTGTTGAAGCATGTTGCGGGCCTATCCGGTGACGAGATTTGCAGAT
GCGATACGCAGGTCTCCATCAACGGGATCACATCTGTTGATGCGCTCAAAGTAACCGAGTCCGGCAGCGC
CCTTCCCGTCTGGCAGGGCTGTCAGACCCTCAAAGCCGGCGACGTTTTCCTGCTCAACTCTCATCCCCTG
TCAGTCGATGGACGATACTTCGGCGTTCAGGACGGCGCGCGCATCATTGGCGTCGCCAGGTCCATATGGA
CTTATGGCAACCGGTCGGCTGAGGATCAGGCGACCGTCAAAGCGATAGATAGCGGGACGGGAATGGCTTC
TGTGTCCCGGAGGGCAAGATTAAGGGAGTGTCACCCAGCGACACTTAACCCATTGTCTGCACATCCTTTT
TTGTGTGACCCGGTGCCGGAAGGCGGGTGCACGGATTTGCAATCCGCTGCGCACTTGGAGCCGTGA
 Primer design