SecReT4
Protein ID: 304322048
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12554
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2553515..2555353 [+]
Productconjugal transfer protein TraG
Component typeTraG
UniProt IDE0TFI9
KEGG IDpbr:PB2503_12554
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9.8e-110, Aligned region: 107..530
TraG-D_C [PF12696], Evalue: 4.3e-34, Aligned region: 377..497
TrwB_AAD_bind [PF10412], Evalue: 1.8e-31, Aligned region: 116..511
AAA_10 [PF12846], Evalue: 3.9e-11, Aligned region: 118..456
Protein Sequence: 612 a.a.     [Download]
>gi|304322048|ref|YP_003855691.1| conjugal transfer protein TraG [Parvularcula bermudensis HTCC2503]
MAGILDHQPRLGGPWFELAGQPVYKPWRLFQWWYAYDAYAPDVFARAGLIASLGGIAGVVMAIIASLWRA
RREKNATTYGSARWSSARDVRRSGLLGTSGVVLGRFRGRYLRHAGAEHVMAFAPTRSGKGVGLVIPTLLS
WTGNAIIHDIKGENWALTSKWRSDFSRCVRFDPTDLSSSRFNPLLEVRLGAHEVRDAQNVADILVDPDGS
LERRSHWDKTAHSLLVGAILHVLYAEDDKSLAGVATLLSDPARPIDDTLERMLEANHLGSRNRPLTHPVV
AEAARELLNKSENEKSSVVSTAISFLGLYRDPVVQRATSGSDWRIEDLFRGESPASLYLVVPPSDLSRTK
PLMRLILNQIARRLCEELPDGKDRRQTLLMLDEFPALGRLDFFESSLAFMAGYGIRAFLIAQSLNQVEKA
YGQNNSILDNCHVRIAFATNDERTAKRISDMLGTTTEQRNQKNYTGHRLAPWLSHVMVSQQETQRPLLTP
GEVMQMPADDALIFLASHPPIRAKKLRYYEDRNFTERVGALPVNSAGADAMRFGGYHRSGPSPSDGNSGG
LARAVGPDIGDEDEISQDIANEEEHAPQQRGGIQDQIARYYLQVQENGGREL
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2553515-2555353 Parvularcula bermudensis HTCC2503 chromosome, complete genome
GTGGCGGGTATTCTGGACCATCAACCGCGTTTGGGCGGACCCTGGTTCGAGCTTGCGGGTCAGCCAGTAT
ACAAGCCGTGGCGGCTGTTCCAGTGGTGGTATGCCTATGATGCTTATGCGCCAGACGTGTTTGCGCGTGC
GGGTTTGATTGCCTCGCTGGGTGGCATCGCCGGTGTTGTAATGGCGATCATCGCGTCGCTCTGGCGGGCA
CGACGCGAGAAGAATGCGACGACCTATGGCTCTGCGCGCTGGTCATCGGCGCGGGACGTTCGGCGATCTG
GTCTGCTTGGTACGTCTGGCGTAGTGCTGGGACGATTCAGAGGCCGGTATCTCCGGCATGCGGGCGCCGA
GCATGTCATGGCCTTCGCGCCGACCCGGTCGGGCAAAGGTGTTGGGTTGGTGATCCCTACCCTTCTGTCC
TGGACAGGCAATGCGATCATTCATGACATCAAGGGAGAGAACTGGGCGCTGACGTCGAAATGGCGGTCGG
ACTTCTCTCGATGCGTTCGGTTCGATCCGACAGACTTGTCGAGTTCACGCTTCAATCCCTTGCTGGAAGT
GCGGCTCGGGGCACATGAGGTCCGCGACGCGCAGAATGTGGCGGACATTCTGGTCGATCCTGATGGCTCT
CTGGAGCGGCGTAGCCATTGGGACAAGACGGCGCATTCACTGCTCGTTGGTGCCATCCTGCACGTTCTAT
ATGCCGAAGATGACAAATCGTTAGCGGGCGTGGCGACGCTGCTGTCTGATCCAGCCCGGCCGATCGATGA
TACGCTGGAGCGCATGCTTGAGGCGAACCATTTGGGAAGCCGCAACCGGCCATTGACGCATCCCGTTGTG
GCGGAGGCGGCACGTGAACTTCTGAACAAGTCGGAGAACGAAAAGTCATCGGTCGTGTCGACGGCCATTT
CGTTCCTGGGGCTCTACCGCGATCCGGTTGTCCAGCGGGCGACCTCCGGTTCGGATTGGCGAATCGAGGA
TTTGTTTCGCGGCGAAAGTCCTGCGTCGTTGTATCTGGTGGTTCCGCCGTCTGATCTCTCGCGGACCAAG
CCGTTGATGCGGTTGATCCTCAATCAGATTGCCCGGCGGCTTTGCGAAGAGCTGCCGGATGGAAAAGACC
GCCGGCAGACCCTGTTGATGCTAGACGAATTCCCTGCGCTTGGACGTCTGGACTTCTTCGAGAGTTCGCT
CGCCTTCATGGCCGGTTATGGGATCCGCGCCTTCCTCATTGCTCAGTCTCTGAACCAGGTCGAGAAGGCC
TATGGGCAGAACAATTCAATCCTCGACAATTGCCATGTCCGGATCGCGTTCGCGACGAATGACGAGCGCA
CTGCCAAGCGTATTTCAGACATGCTCGGCACCACGACAGAGCAGCGAAACCAGAAGAATTATACCGGGCA
CCGGCTCGCGCCCTGGCTCAGTCATGTCATGGTCTCGCAACAGGAAACCCAACGCCCGCTTCTGACGCCC
GGCGAAGTAATGCAGATGCCGGCCGATGACGCGCTGATCTTCCTGGCGAGCCATCCGCCGATCCGGGCGA
AGAAGCTCCGTTACTATGAAGATCGTAACTTCACTGAGCGGGTCGGTGCGTTGCCGGTCAACTCAGCGGG
TGCAGACGCAATGCGGTTCGGTGGATATCATCGATCTGGACCATCCCCCTCAGACGGTAATTCCGGCGGG
CTGGCGCGAGCGGTGGGACCGGACATCGGCGATGAGGATGAGATCTCGCAGGATATTGCGAATGAGGAAG
AGCACGCACCTCAGCAGCGTGGCGGCATTCAGGACCAGATCGCGCGCTACTACCTTCAAGTCCAGGAAAA
TGGCGGACGGGAGCTTTAG
 Primer design