SecReT4
Protein ID: 304322053
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12579
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2561727..2562707 [+]
Productconjugal transfer protein TraB
Component typeTrbB
UniProt IDE0TFJ4
KEGG IDpbr:PB2503_12579
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.8e-83, Aligned region: 25..292
Protein Sequence: 326 a.a.     [Download]
>gi|304322053|ref|YP_003855696.1| conjugal transfer protein TraB [Parvularcula bermudensis HTCC2503]
MSALPQPSETETRRTAMLRTAFDGPVGAALAAPDTIEILANPDGSVWVEKAGFGLRRASETLGRAERERI
IRLVASSVGEVCDRASPIVSAELPGSGERFEGILPPVSEAPCFAIRKPAGQPIALDTYVETGALTPALCV
GLRQALEDRLNIVVAGGTSSGKTTFANALLSEPALAEDRIVILEDTRELRCSAENVTQLRTHRSGITLRD
LVRSTMRLRPDRIIVGEVRGGEALDLLKAWNTGHPGGITTLHANSASGALTRLEQLVEEATTALPHALIG
EAVDVIVFMSRASGARRVEQALRITGFDGTEYRTEPLAAPFLNIVN
 
Nucleotide Sequence: 981 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2561727-2562707 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGTCTGCCCTGCCCCAGCCCAGCGAGACCGAGACCCGCCGTACAGCTATGCTCCGCACGGCCTTCGACG
GTCCAGTTGGGGCAGCGCTGGCGGCGCCTGACACGATCGAGATCCTCGCCAATCCTGACGGCTCGGTCTG
GGTCGAGAAGGCAGGTTTCGGATTGCGCCGGGCATCCGAGACGCTGGGCCGTGCCGAGCGCGAGCGGATC
ATCCGGCTGGTCGCGTCCTCCGTCGGTGAGGTCTGCGACCGGGCGTCTCCGATTGTGTCGGCCGAACTGC
CTGGCTCCGGCGAGCGGTTCGAAGGCATCCTGCCGCCCGTTTCCGAGGCGCCCTGCTTTGCGATCCGCAA
GCCGGCAGGCCAACCGATCGCGCTGGATACCTATGTCGAAACAGGCGCGCTGACGCCGGCGCTTTGTGTC
GGGCTTCGGCAGGCACTTGAAGACCGGCTCAACATTGTTGTTGCGGGCGGCACGTCATCGGGCAAGACGA
CCTTTGCCAATGCATTGCTGTCCGAACCGGCCTTGGCTGAAGACCGGATCGTCATTCTGGAAGACACGCG
CGAGCTCCGCTGCTCCGCCGAAAATGTGACGCAGCTCAGGACGCATCGGTCCGGCATCACGCTTCGCGAT
CTTGTCCGCTCCACCATGCGGCTTCGGCCTGACCGGATCATTGTCGGCGAGGTCCGCGGCGGCGAAGCCC
TCGACCTCCTCAAGGCCTGGAATACCGGCCATCCGGGCGGGATCACCACGCTGCATGCGAATTCCGCCTC
CGGCGCACTGACCCGGCTCGAACAGCTGGTCGAGGAAGCAACGACCGCCCTTCCCCATGCCCTGATCGGC
GAGGCGGTCGATGTGATCGTCTTCATGTCCCGCGCAAGCGGCGCCCGCCGCGTCGAGCAGGCGCTCCGGA
TTACCGGCTTTGACGGCACTGAATACCGGACCGAGCCGCTCGCCGCCCCCTTTCTCAACATCGTCAATTA
A
 Primer design