SecReT4
Protein ID: 304322054
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12584
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2562720..2563052 [+]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDE0TFJ5
KEGG IDpbr:PB2503_12584
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.1e-24, Aligned region: 6..101
Protein Sequence: 110 a.a.     [Download]
>gi|304322054|ref|YP_003855697.1| conjugal transfer protein Trbc [Parvularcula bermudensis HTCC2503]
MFYDQIKALNRSLQAGVLLTSVSVLSLPAHAAGTGMPWEGPLDQILQSIEGPVARIVAVIIITLTGLTLA
FGETSGGFRKLIQIVFGLSIAFAATSFFLTFFSFGGGAVL
 
Nucleotide Sequence: 333 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2562720-2563052 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGTTCTACGACCAGATCAAGGCCCTCAACCGGTCGCTTCAGGCCGGCGTGCTGCTGACCTCGGTGAGCG
TGCTGTCACTGCCGGCCCATGCCGCCGGCACCGGCATGCCCTGGGAAGGCCCGCTCGACCAGATCCTGCA
ATCCATCGAAGGCCCTGTCGCCCGGATCGTGGCGGTGATCATCATCACGCTCACCGGCCTGACACTCGCC
TTCGGGGAGACGTCCGGCGGGTTCCGCAAGCTGATCCAGATCGTGTTCGGCCTGTCGATCGCCTTTGCGG
CGACCAGCTTCTTCCTGACCTTCTTCTCCTTCGGCGGCGGCGCGGTGCTCTAG
 Primer design