SecReT4
Protein ID: 304322055
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12589
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2563052..2563306 [+]
Productconjugal transfer trbd transmembrane protein
Component typeTrbD
UniProt IDE0TFJ6
KEGG IDpbr:PB2503_12589
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.4e-10, Aligned region: 1..76
Protein Sequence: 84 a.a.     [Download]
>gi|304322055|ref|YP_003855698.1| conjugal transfer trbd transmembrane protein [Parvularcula bermudensis HTCC2503]
MLDGYEIPLHRSLAEPILMAGAPRSAAIAIGTIAAALALGLRLWIPGLVVWVAGHSLAVLMARSDPDFLA
VAIRSARHKEHLSC
 
Nucleotide Sequence: 255 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2563052-2563306 Parvularcula bermudensis HTCC2503 chromosome, complete genome
GTGCTGGACGGCTACGAGATCCCCCTCCACCGCTCGCTTGCCGAGCCCATCCTGATGGCGGGCGCGCCGC
GCTCGGCCGCCATTGCCATCGGGACGATTGCAGCAGCTTTGGCCCTCGGCCTCCGGCTCTGGATACCGGG
CCTCGTCGTCTGGGTGGCGGGGCACTCGCTCGCTGTCCTCATGGCCCGGTCCGACCCGGACTTCCTGGCC
GTCGCAATCCGGTCGGCCCGCCATAAGGAACACCTTTCATGCTGA
 Primer design