SecReT4
Protein ID: 304322056
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12594
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2563300..2565738 [+]
Productconjugal transfer protein Trbe
Component typeTrbE
UniProt IDE0TFJ7
KEGG IDpbr:PB2503_12594
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.1e-40, Aligned region: 443..720
CagE_TrbE_VirB [PF03135], Evalue: 3.6e-19, Aligned region: 182..288
CagE_TrbE_VirB [PF03135], Evalue: 3.6e-19, Aligned region: 298..389
TraG-D_C [PF12696], Evalue: 8.6e-05, Aligned region: 636..720
Protein Sequence: 812 a.a.     [Download]
>gi|304322056|ref|YP_003855699.1| conjugal transfer protein Trbe [Parvularcula bermudensis HTCC2503]
MLNLSEYATRQASLADFLPWACLVAPGVVLNKDGAFQTSFRYRGPDLESSTEAELVAVTARVNNVLRRFG
SGWALFFEAVRAEAVSLEESEFACAAAWLIEQERRAAAEETGARFESAYYLTLLWLPPADATGQAEKALI
ERPEKRDGEDWRQRLEHFQTRAAQTLDLLSTALDEIHPLSDEETLTYLHACISSKRHAVSVPELPVFLDA
VLADESFAGGLEPRIGEAHLATLTLLGFPASTLPGMLDELNRLGFSYRWTTRYIAMDKAEAEKLLAKKRR
HWFAKRKSVGAVLRETLFNEQAALLDNDADNKAADADAALQELGSDLVSYGYVTTTLTLMGSSREEVEER
TRAVERVINGRGFTTIRETLNAVEAWLGSLPGHVYANVRQPILHTLNLAHLVPISSVWAGDAWNDHLSDR
ALIEAQTEGTTPFRLNMHVGDVGHTLIIGPTGSGKSVLLSLLAAQWQRYSDAQVFLFDKGRSARAVTLAM
EGTWLPLAGDERPALQPLRDIDTDRGASFAADWLLGLIEAEGVTVTPDLKSVLWDAVRSLSSAPVAERTL
TGLSLILQSDKLKAALHPYTLEGAYGHLLDSDAEALDLSAVACFEMDELMQTPSAVAPVITYLFHRLEDR
FYGRPTLLILDEAWLFLDHPVFAARLRDWLKTLRKKNVAVVFATQSLADIEGASIAPALIESCPTRIFLP
NERALEPTAQAIYRRFGLNDRQIDILAKAIPKRDYYYTSPHGCRLFELGVGDVALAFCGAASPADQKLMD
GLLEADAETGFARGWLELKQLGWAADLLAGQPDAPLPQIAAE
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2563300-2565738 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGCTGAACCTCTCTGAATACGCGACCCGGCAGGCCAGTCTTGCCGATTTCCTCCCCTGGGCGTGCCTGG
TCGCGCCGGGCGTCGTCCTCAACAAGGACGGCGCCTTCCAGACCAGCTTCCGCTATAGGGGCCCCGACCT
TGAAAGCTCGACGGAAGCCGAACTCGTTGCGGTCACCGCTCGGGTCAATAATGTGCTCCGCCGGTTCGGG
TCCGGCTGGGCGCTCTTCTTCGAAGCGGTGCGGGCGGAAGCGGTCTCGCTGGAAGAGAGTGAGTTTGCAT
GCGCTGCCGCCTGGCTGATCGAGCAGGAACGCCGCGCAGCCGCCGAGGAGACCGGCGCCCGCTTCGAGAG
CGCCTATTACCTCACACTACTCTGGCTGCCGCCCGCCGATGCGACGGGGCAGGCCGAAAAGGCCCTGATC
GAGCGGCCCGAAAAGCGTGACGGCGAGGACTGGCGCCAGCGGCTGGAGCACTTCCAGACACGCGCGGCGC
AGACACTCGATTTGCTGTCGACTGCATTGGACGAGATCCATCCGCTCTCGGATGAAGAGACCCTCACCTA
CCTTCATGCTTGCATCTCGTCGAAGCGGCATGCCGTGTCGGTTCCGGAACTGCCGGTCTTTCTCGATGCG
GTGCTGGCCGATGAGAGTTTTGCGGGCGGGCTCGAGCCGCGGATTGGCGAGGCGCATCTAGCGACGCTGA
CCCTGCTTGGCTTTCCGGCCTCGACCCTGCCCGGCATGCTGGATGAGCTGAACCGGCTTGGCTTCTCCTA
TCGCTGGACGACGCGCTATATCGCGATGGACAAGGCCGAGGCCGAAAAGCTCCTCGCCAAGAAGCGCCGG
CACTGGTTCGCCAAGCGCAAATCCGTTGGAGCCGTCCTTCGAGAGACGCTTTTCAACGAACAAGCCGCGC
TTCTCGACAATGATGCCGACAACAAGGCGGCCGATGCCGATGCGGCGTTGCAGGAGCTTGGCTCTGATCT
TGTCTCCTATGGCTATGTCACCACCACGCTGACCTTAATGGGGTCCTCGCGTGAGGAAGTCGAGGAGCGC
ACCCGCGCCGTCGAACGCGTGATCAATGGGCGCGGGTTCACGACGATCCGCGAGACGCTGAACGCCGTCG
AAGCCTGGCTTGGCTCCCTGCCGGGACATGTCTATGCCAATGTCCGCCAGCCGATCCTGCATACGCTGAA
CCTTGCCCATCTTGTTCCGATATCTTCGGTCTGGGCGGGCGATGCCTGGAACGATCATCTGTCCGATCGC
GCGCTAATCGAAGCGCAGACCGAAGGCACGACGCCGTTCCGGCTTAACATGCATGTCGGCGATGTCGGCC
ATACGCTGATCATTGGGCCGACAGGCTCCGGCAAATCGGTACTCCTGTCGCTGCTGGCGGCGCAATGGCA
GCGCTATAGCGATGCGCAGGTGTTCCTCTTCGACAAGGGACGATCCGCGCGGGCGGTGACGCTCGCCATG
GAAGGCACCTGGCTGCCGCTGGCGGGCGATGAGCGTCCGGCATTGCAACCGCTTCGGGATATCGACACCG
ACCGCGGCGCAAGCTTTGCCGCAGACTGGCTGCTCGGGCTGATCGAAGCCGAGGGCGTGACCGTTACGCC
GGACCTGAAGTCCGTCTTGTGGGACGCGGTGCGATCGCTGTCGTCAGCACCAGTCGCAGAGCGCACACTG
ACCGGGCTCAGCCTCATTCTGCAATCGGATAAGCTGAAAGCGGCGCTCCATCCGTACACGCTGGAAGGGG
CCTATGGGCACCTACTCGACAGCGATGCGGAAGCCCTCGACCTTTCTGCGGTTGCCTGTTTCGAGATGGA
CGAGCTGATGCAGACGCCATCTGCGGTCGCGCCGGTCATCACCTATCTCTTCCACAGGCTGGAAGACCGG
TTCTATGGCCGCCCGACCCTGCTCATTCTCGATGAAGCCTGGCTGTTCCTTGATCATCCGGTGTTCGCAG
CGCGCCTCCGCGACTGGCTTAAGACGCTTCGGAAAAAGAACGTCGCCGTCGTGTTTGCGACCCAGTCGCT
TGCCGACATTGAAGGGGCGTCCATTGCGCCCGCCCTGATCGAATCCTGCCCGACAAGGATCTTCCTGCCG
AATGAGCGTGCGCTCGAACCCACTGCCCAGGCCATCTATCGCCGGTTCGGACTGAACGATCGCCAAATCG
ACATTCTCGCCAAGGCAATCCCGAAGCGGGACTATTACTATACCTCGCCCCACGGCTGTCGGCTCTTCGA
GCTTGGCGTTGGCGATGTCGCCCTTGCCTTTTGCGGCGCCGCTTCCCCCGCCGACCAGAAGCTCATGGAT
GGGCTTCTGGAAGCCGACGCGGAAACGGGCTTCGCCCGTGGCTGGCTGGAGTTGAAACAGCTCGGCTGGG
CAGCCGACCTGCTGGCCGGACAACCCGATGCACCCCTCCCCCAAATCGCCGCTGAATAG
 Primer design