SecReT4
Protein ID: 304322057
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12599
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2565750..2566463 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDE0TFJ8
KEGG IDpbr:PB2503_12599
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|304322057|ref|YP_003855700.1| conjugal transfer protein TrbJ [Parvularcula bermudensis HTCC2503]
MKALLSSVALAAIPLSGLIAPPASAQLFGGGIVYDPTNHAENILQAVRALQQIDNQIRQLTHEIDMIEKM
ARDLETLPVEVARGIIADRIRRIEELMREADGIGYGVEEVEREYEDLYPETYGETPPANAVLVEDARVRW
QQSRSAHKHTLLMVAETVRDNERDAEALTGLVEESQTAVGNLQVLQAGNQIDAMSAQQLMQMEAMMAAHY
RAEALDRARELEEAERGRARLQSFLGN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2565750-2566463 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGAAAGCCCTTCTCTCCTCTGTCGCCCTAGCCGCCATTCCGCTATCGGGCCTTATTGCGCCGCCTGCCT
CCGCGCAGTTGTTCGGCGGCGGCATTGTCTACGACCCGACCAATCATGCCGAGAACATCCTCCAGGCGGT
GCGCGCCCTGCAGCAGATCGACAACCAGATCCGCCAGCTCACCCATGAAATCGACATGATCGAGAAGATG
GCGCGCGACCTGGAAACGCTTCCTGTTGAGGTCGCGCGCGGCATTATTGCTGACCGCATCCGTAGAATTG
AAGAGTTGATGCGCGAAGCCGACGGTATCGGCTACGGCGTCGAGGAGGTCGAACGCGAATACGAGGACCT
CTATCCCGAAACCTATGGCGAGACGCCGCCTGCCAATGCTGTGCTGGTCGAGGATGCGCGGGTGCGCTGG
CAGCAATCCCGCTCGGCGCACAAGCACACGCTGCTTATGGTCGCCGAGACGGTTCGCGACAATGAACGCG
ATGCCGAGGCGCTGACTGGTCTTGTCGAAGAGAGCCAGACCGCCGTCGGTAATCTCCAGGTCCTGCAGGC
TGGCAACCAGATCGATGCCATGTCGGCACAGCAGCTGATGCAGATGGAAGCCATGATGGCCGCCCATTAC
CGCGCCGAGGCCCTCGACCGGGCGCGCGAGCTGGAAGAAGCCGAGCGCGGCCGCGCGCGCCTCCAAAGCT
TCCTCGGGAACTAG
 Primer design