SecReT4
Protein ID: 304322058
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12604
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2566470..2567789 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDE0TFJ9
KEGG IDpbr:PB2503_12604
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.1e-47, Aligned region: 37..263
Protein Sequence: 439 a.a.     [Download]
>gi|304322058|ref|YP_003855701.1| conjugal transfer protein TrbL [Parvularcula bermudensis HTCC2503]
MEEMGVIDRFLETFIAYVDSGFGLLAGDVAYLTTTLIVIDITLAGLFWALSQNADVISGLLKKVLYVGFF
AFILGNFSILANILFASFADLGVKAGSSTLTAEDLMRPGYIAGVGFEAAQPLLQEIGDMLGPIRFFHNFI
LIAVMLIAWAIILVAFFVLAVQLFVAILEFKLTTLAGFVLVPFALWNKTSFLAERVLGNVVTSGIKLMVL
AIVIGIGSTLFTSITEAFGGPGDVTLAEVMGTVLAAIVFLWMGVFAPGIASGLVTGAPQLGAGSVVGTTA
AVGAGAVLATTGTVAAGRAAMGGVSGAVKAGASMSGGARTSYDLGRMASGHSGWRGATAGMAGVAQAGGD
TLRRMAGRPFASVGNAYRRGSEAAFAATGGTMAAVPGDAPSAGSASPAWARRLRTEQRLQHAGAITVHAL
KDGDRGMAGDNPKLRNEED
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2566470-2567789 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGGAAGAGATGGGCGTCATCGACCGGTTCCTGGAGACCTTCATTGCCTATGTGGATTCAGGCTTCGGCC
TGCTTGCGGGCGATGTCGCTTACCTGACAACCACGCTGATCGTGATCGACATCACGCTGGCCGGGCTTTT
CTGGGCCCTCTCGCAGAATGCCGATGTGATATCGGGGCTCCTGAAGAAGGTGCTCTATGTCGGCTTCTTC
GCCTTCATCCTTGGCAATTTCTCCATCCTGGCGAACATCCTCTTTGCGAGCTTTGCCGATCTCGGTGTGA
AGGCCGGCTCCTCGACGCTGACGGCTGAGGATTTGATGCGGCCCGGCTATATCGCAGGGGTCGGGTTCGA
GGCGGCGCAGCCGCTTCTGCAAGAGATCGGCGACATGCTGGGGCCGATCCGCTTCTTCCATAATTTTATT
CTGATCGCGGTCATGCTGATTGCCTGGGCGATCATTCTCGTCGCCTTCTTCGTTCTGGCCGTCCAGCTCT
TCGTTGCCATCCTCGAGTTCAAGCTGACGACGCTGGCGGGCTTCGTGCTCGTGCCCTTCGCGCTCTGGAA
CAAGACGTCATTCCTCGCCGAACGCGTGCTGGGCAATGTCGTCACATCCGGCATCAAGCTGATGGTGCTC
GCTATCGTGATCGGCATTGGCTCGACGCTGTTCACGTCTATCACGGAGGCCTTTGGCGGGCCGGGCGATG
TGACGCTGGCTGAAGTGATGGGCACGGTGCTCGCCGCAATCGTCTTCCTCTGGATGGGTGTCTTTGCGCC
CGGTATCGCCTCCGGCCTTGTGACCGGCGCCCCGCAACTCGGCGCGGGGTCCGTAGTCGGCACGACGGCT
GCCGTTGGCGCAGGCGCTGTGCTGGCGACGACGGGAACTGTCGCGGCAGGCCGCGCAGCGATGGGCGGCG
TGTCCGGCGCCGTAAAGGCCGGGGCATCCATGTCGGGCGGTGCCCGCACTTCTTATGACCTCGGCCGCAT
GGCGTCCGGTCATTCTGGATGGCGCGGCGCGACAGCGGGTATGGCCGGTGTTGCGCAGGCCGGCGGCGAT
ACGCTCCGCCGGATGGCCGGACGGCCCTTCGCCTCTGTCGGTAATGCTTATCGGCGTGGAAGCGAAGCGG
CCTTTGCCGCGACCGGCGGGACCATGGCGGCGGTGCCCGGCGATGCGCCGTCTGCCGGCTCCGCCAGCCC
CGCCTGGGCACGGCGCCTTCGCACTGAACAACGCCTGCAACATGCCGGCGCGATTACGGTCCATGCCCTG
AAGGACGGTGATCGCGGCATGGCGGGCGACAATCCGAAACTCCGAAACGAAGAGGACTGA
 Primer design