SecReT4
Protein ID: 304322059
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12609
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2567789..2568493 [+]
ProductConjugal transfer protein
Component typeTrbF
UniProt IDE0TFK0
KEGG IDpbr:PB2503_12609
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.7e-55, Aligned region: 24..227
Protein Sequence: 234 a.a.     [Download]
>gi|304322059|ref|YP_003855702.1| Conjugal transfer protein [Parvularcula bermudensis HTCC2503]
MSMAFRRTSTHYGQSPHPETPYQKAGQVWDERIGSARVQAKNWRLMALGLLGLLAASSAALVWRSLQSTV
TPYVVEVDDTGAVKAVGPALAKYEPTDAQIAHHLANFISDIRSLSIDPVIVRQNWLAAYDYVTDKAAITL
SDYARDNDPFAEIGRRSRSVDVVSVVRVSDESFQARWLEKTYENGALTGVKRFTGLFTLVNSPPRDAETL
RANPLGLYIHSLNWGEDLVTGDNQ
 
Nucleotide Sequence: 705 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2567789-2568493 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGAGCATGGCCTTCCGGCGCACCTCCACCCATTACGGGCAAAGCCCGCATCCCGAAACGCCCTATCAGA
AGGCGGGCCAGGTCTGGGACGAACGGATCGGTTCGGCCCGCGTCCAGGCCAAGAACTGGCGGCTGATGGC
GCTGGGATTGCTGGGGCTTCTAGCGGCCTCCTCTGCTGCTCTTGTCTGGCGCAGCCTGCAATCGACCGTC
ACCCCCTATGTGGTCGAGGTGGATGATACCGGCGCTGTGAAGGCGGTCGGGCCAGCGCTTGCGAAATATG
AGCCGACAGACGCACAGATCGCGCATCATTTGGCAAACTTCATTTCCGATATCCGGAGCCTGTCGATTGA
TCCGGTCATCGTCCGGCAGAACTGGCTCGCCGCCTATGACTATGTCACCGACAAGGCGGCGATCACGCTC
AGCGATTACGCCCGCGACAATGACCCTTTCGCCGAAATCGGCCGGCGCTCGCGCAGCGTTGATGTGGTGA
GCGTGGTGCGGGTCTCGGACGAGTCCTTCCAGGCCCGCTGGCTTGAGAAGACCTATGAGAACGGCGCGCT
CACTGGGGTCAAACGGTTCACGGGGCTGTTCACCCTTGTGAACTCTCCGCCGCGCGATGCCGAAACGCTC
CGCGCCAATCCTCTCGGCCTCTACATCCACAGCCTCAATTGGGGCGAAGACCTTGTCACAGGAGACAACC
AATGA
 Primer design