SecReT4
Protein ID: 304322060
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12614
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2568490..2569497 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDE0TFK1
KEGG IDpbr:PB2503_12614
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.2e-69, Aligned region: 99..320
Protein Sequence: 335 a.a.     [Download]
>gi|304322060|ref|YP_003855703.1| conjugal transfer protein TrbG [Parvularcula bermudensis HTCC2503]
MIRTMILVSALALTTACASVPPEPVLEDTAFVEAAFVDEVPERPVEIVETPTVLALPGQMKPVDGTKRTV
TRVYTSPTETIRKGTTEARIEPSVDGYVNAIQVYPYTEGALYRLYAAPGQVSDIALQPGETLVSVSAGDT
VRWIVGDTSSGSGGAARAHVLVKPIAAGLSTNLMIATDRRTYHLELESVDGTYMAALSWRYPADELAELV
SRNKIASVREDASIASGVAVDRLDFDYVIEGDKPAWRPVRVFDDGRQVFIQMPAGLATMDAPPLFILGAS
GDAELVNYRLRGNYYIVDHLFRAAELRIGEKDQTVVRIRKRVQRSGLASLFGAEG
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2568490-2569497 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGATCCGTACAATGATCCTTGTATCCGCCCTTGCCCTGACCACGGCCTGCGCGAGCGTTCCGCCGGAAC
CTGTCCTCGAAGATACTGCGTTTGTCGAAGCGGCGTTCGTTGATGAGGTGCCAGAGCGGCCTGTCGAGAT
TGTCGAGACGCCGACCGTGCTGGCGCTCCCCGGCCAGATGAAACCGGTCGACGGCACGAAGCGGACCGTG
ACGCGGGTTTATACGTCTCCGACAGAGACGATCCGCAAGGGCACGACCGAGGCCCGGATCGAACCTTCTG
TCGATGGCTATGTGAACGCGATCCAGGTCTATCCCTATACAGAAGGCGCACTCTACCGGCTCTATGCCGC
GCCGGGCCAGGTCTCGGACATTGCGCTGCAGCCGGGCGAGACGCTGGTCTCGGTGTCGGCGGGAGACACG
GTCCGCTGGATTGTCGGGGATACGTCCTCCGGTTCCGGCGGCGCGGCCCGCGCGCACGTGCTCGTCAAAC
CGATCGCGGCAGGTCTTTCGACCAATCTGATGATCGCGACCGACCGGCGGACCTATCATCTTGAACTGGA
AAGCGTAGATGGCACCTATATGGCGGCCCTCTCCTGGCGCTATCCGGCGGACGAACTCGCTGAATTGGTC
TCCCGCAACAAGATTGCGTCCGTTCGCGAGGACGCGTCCATTGCGTCCGGTGTCGCCGTTGACCGGCTCG
ACTTCGATTATGTCATTGAAGGCGACAAGCCGGCCTGGCGGCCTGTGCGCGTCTTCGACGATGGACGGCA
GGTCTTTATCCAGATGCCGGCCGGACTTGCCACCATGGATGCCCCGCCGCTCTTCATCCTTGGTGCCTCA
GGTGATGCCGAACTCGTCAATTATCGCCTGCGTGGCAATTACTACATCGTCGACCATCTCTTCCGCGCCG
CCGAACTGCGGATCGGCGAGAAGGATCAGACCGTGGTGCGGATCCGCAAGCGCGTGCAGCGCTCCGGTCT
TGCGAGCCTGTTCGGAGCAGAGGGATGA
 Primer design