SecReT4
Protein ID: 304322061
T4SS name [ID]Trb [355]
Gene symbol-
Locus tagPB2503_12619
StrainParvularcula bermudensis HTCC2503
Repliconchromosome [GenBank: NC_014414] [Browse all T4SS(s) in this replicon]
Location [Strand]2569494..2570750 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDE0TFK2
KEGG IDpbr:PB2503_12619
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.6e-58, Aligned region: 234..410
Protein Sequence: 418 a.a.     [Download]
>gi|304322061|ref|YP_003855704.1| conjugal transfer protein TrbI [Parvularcula bermudensis HTCC2503]
MSEPAPFPKQADELKLRARPRPVTRINRKVLMAGACLGVLGLFAAASIALDPPKAVDPADRQELYNTATK
RAPDGLADLPNSYLNWQPAGDTPKLGAPMAGDLGGTVVAEEEEWGLEPDWNVAPSDDFRPSAEDEAIRAQ
RLADAKLADAAGKAGVFFDVGNRQSLTGSVSAPGGLPNSLGSELLALAAQGAGAPGFAGSPDQNLQAEKI
AFAAETRDGDIYNPHDVETPVSPYQVMAGTLIPASLVTGLNSDLPGNVIAQVTQPVYDTVSGTHLLIPQG
ARLIGRYQSEISFGQERALLIWDRIILPDGSSLQISEPASDAQGYAGVSDRTDHHWDRVFAAAGLATLLG
IGSELGSDEGDVERAIRRGFGDSVSEAGQRVVDRNLGIQPTIRIRPGWPVRVIVTRDLVLRPYSEGGR
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|304319677|ref|NC_014414.1|:2569494-2570750 Parvularcula bermudensis HTCC2503 chromosome, complete genome
ATGAGCGAGCCGGCCCCCTTCCCGAAACAGGCCGATGAGCTGAAACTGCGCGCGCGGCCGCGGCCGGTCA
CACGGATCAACCGAAAGGTTCTGATGGCGGGTGCCTGTCTTGGCGTGCTGGGCCTGTTTGCCGCCGCATC
CATCGCGCTTGATCCACCCAAGGCCGTCGATCCGGCGGACCGGCAGGAGCTTTACAATACGGCGACCAAG
CGCGCTCCGGATGGGCTGGCAGACCTGCCAAACTCCTACCTCAATTGGCAACCGGCTGGTGACACGCCGA
AGCTCGGCGCACCCATGGCAGGCGACCTTGGCGGCACAGTCGTGGCTGAAGAGGAAGAATGGGGACTCGA
ACCCGATTGGAATGTGGCGCCCTCGGATGACTTCCGGCCCTCTGCCGAGGATGAAGCCATTCGTGCGCAG
AGGTTGGCGGATGCAAAACTCGCCGATGCAGCTGGCAAGGCGGGCGTCTTCTTCGATGTCGGCAACCGGC
AGTCGCTAACTGGGTCGGTGTCTGCACCAGGCGGCCTGCCGAACAGTCTCGGCTCGGAACTGCTGGCACT
CGCGGCCCAGGGCGCAGGCGCGCCGGGCTTTGCAGGCTCGCCGGATCAGAACCTCCAGGCAGAGAAGATC
GCGTTCGCCGCAGAGACGCGGGATGGCGACATCTACAACCCCCATGATGTCGAGACCCCGGTCTCGCCCT
ATCAGGTGATGGCGGGCACGCTGATCCCGGCCTCGCTCGTCACCGGGCTGAATTCTGACCTGCCGGGCAA
TGTAATCGCGCAGGTGACCCAGCCCGTCTATGACACGGTCAGTGGCACGCATCTGCTCATCCCGCAAGGC
GCGCGCCTGATCGGGCGCTACCAGTCGGAAATATCGTTCGGCCAGGAGCGCGCGCTCCTGATCTGGGACC
GGATCATCCTGCCGGATGGCAGTTCGCTGCAAATATCTGAACCTGCTTCGGATGCGCAGGGCTACGCCGG
TGTTTCCGACCGAACCGACCATCACTGGGACCGCGTCTTTGCGGCCGCGGGGCTCGCCACGCTCCTCGGC
ATCGGCTCCGAGCTTGGCTCGGACGAGGGCGATGTCGAGCGCGCGATCCGGCGTGGATTCGGGGACAGTG
TCTCCGAAGCCGGTCAGCGTGTCGTCGACCGCAATCTCGGCATTCAGCCAACGATCCGTATACGGCCGGG
CTGGCCAGTGCGGGTGATCGTAACACGCGATCTTGTGCTGCGGCCTTATTCTGAGGGAGGCCGGTGA
 Primer design