SecReT4
Protein ID: 305667852
T4SS name [ID]Tra_I [165]
Gene symboltraU
Locus tagpCT_072
StrainEscherichia coli plasmid pCT (NC_014477)
Repliconplasmid pCT [GenBank: NC_014477] [Browse all T4SS(s) in this replicon]
Location [Strand]54449..57493 [-]
Productconjugal transfer nucleotide-binding protein
Component typeTraU_I
UniProt IDE0WH10
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.2e-42, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|305667852|ref|YP_003864326.1| conjugal transfer nucleotide-binding protein [Escherichia coli]
MNINRIIFAIEDCISTLSRYSVSAFFPDYCDLHTVIGLDQQDRERRPWLKAPYIATTKQGYYLSVFEISG
ALKEMDENPDQTAPGTLESLIAALAERMNTAWKNSGHKISFVFERDPERGRDEIEAMLLPQRKSIARTGI
LLQDVLDEKVTTLTPWLVRERCWLTVWSSEELLSRTDRKDHQTRVRKLAEHAPPARFAQDPWRWTLSALK
IRHDALLDTLEQALTHDSDGLLIRLMDIHEVGREIRRQLERNSTPAVWQPHLPEDARPAGWRQGGDTSVF
HAPSLNLQLFTTQPETHGSLIQAGELWHGMVAITLPPQNLRTFNQLVRDVPRAIPWRIRMDLMPDGMKAL
GVKKTLLTYSSFIPPLRPMYDSVMMLNDINKHDPVCIMTIVATTWGNSREVCTRNQALLKSALEGWGVCG
TTTTFGDPRRAWVNTVLAASHSSGPIPLYPPLSHALSLFPLNRAGSVWRGQGNLMMHTEDGSAWEVALAS
SQQNKHTELTPGAPGLGKSVLINALSEIQIASAQKNLPFIAYIDKGFSAQGLVQLIRDSLPEQRKDEAVG
IILSNDPDHTRNLFDVMYGARKPVTPEKNFMVSVLCALCVDTGTGQPCNPGDTRQIISSLVDLAFREYGE
NNPRLYRAGTEPLVDLALEESGIAEQHDAGWWNAATWFEIRDMLHIAGNIPAAQRAHYQAMPLLAEMSAL
LGQPSIRDVFGTVQRDNSEERLLDYIRRALDQGHSDYPMMSGCTRFMLSPDTRVVAVDLNNVAGDKTPAG
RLRTGIMYLLAGQIAGGDFVLPQYQEEIRKNLDPRYHEVIFRRIEQLDQEVKTKVYDELHNAKGINFIWE
ALDTQELEQRKFGIRTVLSTQLLQHYPPAVLKSANTLWLLRYRPDEIPFLRDNFGVPEVTLRRFLKMPEG
AAPDGSGVPVLAVFRVKNGTLARILKFTLGPLELWALNSSPKDSALRRALTQEVGSLRARQILAEHFPRG
SATSLIEHRARTHDSENIIHELAAELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|305667788|ref|NC_014477.1|:c57493-54449 Escherichia coli plasmid pCT, complete sequence
ATGAATATCAACCGCATTATTTTTGCCATTGAAGACTGTATCAGTACCCTGTCACGGTATTCCGTTTCCG
CATTCTTCCCCGATTACTGTGATCTGCACACCGTCATCGGTCTGGACCAGCAGGACCGCGAACGCCGCCC
CTGGCTGAAAGCCCCCTACATTGCCACCACAAAACAGGGGTATTACCTTTCCGTCTTTGAAATCAGCGGT
GCCCTGAAAGAAATGGATGAAAACCCGGACCAGACGGCCCCCGGGACACTGGAGTCACTGATTGCAGCAC
TGGCTGAGCGAATGAACACGGCCTGGAAAAATTCCGGCCACAAAATCAGTTTTGTTTTCGAACGCGATCC
GGAGCGTGGAAGGGATGAAATCGAAGCCATGCTCTTACCCCAGCGAAAATCCATCGCACGCACGGGGATC
CTGCTTCAGGACGTCCTGGATGAAAAAGTCACCACACTCACCCCCTGGCTTGTCCGGGAGCGCTGCTGGC
TGACCGTCTGGAGCTCTGAAGAACTGCTGAGCCGGACCGATCGCAAGGACCATCAGACCCGTGTCAGGAA
ACTAGCTGAACACGCTCCGCCAGCCCGTTTTGCGCAGGATCCCTGGCGCTGGACACTTTCCGCCCTCAAA
ATACGGCATGACGCCTTACTGGACACGCTGGAGCAGGCCCTGACACATGATTCTGATGGCCTGCTGATTC
GCCTGATGGATATCCATGAAGTGGGACGGGAAATCCGCCGCCAGCTGGAGCGCAACAGTACACCGGCAGT
ATGGCAGCCTCATCTGCCTGAAGATGCCCGTCCTGCCGGCTGGCGACAGGGCGGGGATACCTCTGTATTC
CACGCACCGTCGCTGAATCTGCAGTTATTCACCACACAGCCTGAAACACACGGCAGCCTGATTCAGGCCG
GTGAGCTCTGGCACGGTATGGTCGCCATTACCCTGCCCCCTCAGAATCTGCGGACATTCAACCAGCTGGT
CAGGGATGTGCCCCGTGCAATCCCCTGGCGTATCCGGATGGATCTGATGCCCGACGGCATGAAGGCGCTG
GGGGTCAAGAAAACCCTGCTGACCTACAGCAGCTTTATTCCTCCTCTCCGGCCCATGTATGACTCGGTAA
TGATGCTGAATGACATCAACAAGCATGATCCGGTCTGTATCATGACCATTGTTGCCACCACATGGGGAAA
CAGCCGGGAAGTCTGTACCCGTAACCAGGCTCTCCTGAAATCTGCGCTGGAAGGCTGGGGGGTATGCGGC
ACCACCACAACCTTCGGTGATCCGAGACGTGCCTGGGTGAACACGGTTCTGGCAGCCTCCCACAGCTCCG
GCCCGATCCCCCTTTACCCGCCCCTTTCACACGCCCTTTCCCTGTTTCCCCTGAACAGGGCAGGCTCTGT
CTGGCGGGGACAGGGAAATCTGATGATGCACACCGAAGACGGCTCTGCATGGGAGGTGGCGCTGGCGTCA
TCACAACAGAACAAGCACACGGAGCTGACACCCGGCGCACCCGGTCTGGGCAAATCGGTACTCATCAACG
CACTGTCGGAGATCCAGATAGCCTCAGCCCAGAAGAATCTCCCTTTCATTGCCTATATCGACAAGGGATT
CAGTGCACAGGGACTGGTACAGCTTATCCGTGACAGCCTGCCTGAGCAGAGAAAGGACGAAGCCGTGGGG
ATCATTCTGAGTAATGACCCGGACCACACCCGCAACCTGTTTGATGTGATGTACGGGGCCAGAAAACCCG
TCACACCGGAAAAGAACTTCATGGTCTCCGTCCTCTGTGCATTGTGTGTGGATACCGGCACCGGTCAGCC
CTGTAATCCCGGCGACACCCGGCAAATCATCAGCAGCCTGGTGGACCTGGCCTTCCGGGAATATGGCGAG
AATAACCCCAGACTTTACCGCGCAGGTACGGAACCCCTGGTGGATCTTGCCCTGGAAGAGAGCGGCATCG
CTGAACAACATGATGCCGGATGGTGGAATGCCGCCACCTGGTTTGAAATCAGGGACATGCTGCATATTGC
AGGGAATATCCCCGCCGCCCAGCGGGCACACTACCAGGCCATGCCCCTGCTGGCTGAAATGTCCGCCCTG
CTGGGACAGCCGTCCATCCGGGATGTGTTCGGCACCGTTCAGCGTGATAACTCGGAAGAGCGGTTGCTGG
ACTACATCCGCCGTGCCCTCGATCAGGGACACAGTGACTACCCGATGATGTCCGGCTGTACCCGGTTTAT
GCTCAGCCCCGACACCCGCGTGGTCGCCGTTGATCTGAACAATGTGGCCGGGGACAAGACACCTGCCGGA
CGTCTGCGCACCGGTATCATGTATCTGCTGGCCGGGCAGATCGCCGGCGGGGATTTTGTCCTGCCGCAGT
ATCAGGAGGAAATACGGAAAAATCTCGACCCACGCTACCATGAGGTGATTTTCCGCCGCATTGAACAGCT
TGATCAGGAGGTCAAGACCAAAGTCTATGACGAACTGCACAATGCAAAAGGGATCAACTTCATCTGGGAA
GCCCTGGACACCCAGGAGCTGGAGCAGCGTAAGTTCGGGATACGCACGGTGCTGAGCACCCAGCTGCTGC
AGCATTATCCTCCGGCCGTGCTCAAATCCGCCAACACCCTGTGGCTGCTGCGTTACCGCCCTGACGAAAT
TCCGTTCCTGCGGGATAACTTTGGCGTCCCGGAAGTCACACTGCGGCGCTTCCTGAAAATGCCGGAAGGG
GCCGCACCGGACGGCAGCGGTGTCCCGGTACTGGCTGTGTTCCGTGTAAAAAACGGCACGCTGGCCCGGA
TCCTGAAATTCACCCTCGGTCCACTGGAGCTGTGGGCACTGAACTCCTCTCCTAAAGACAGCGCCCTGCG
ACGTGCGCTGACGCAGGAGGTGGGGTCACTGCGGGCACGCCAGATCCTGGCCGAACACTTTCCCCGGGGT
TCAGCCACCTCACTGATAGAACACCGCGCCCGCACACATGACAGTGAAAACATCATCCATGAGCTGGCAG
CAGAACTCATCCGTAAGCAGGGATATAACCTCTGA
 Primer design