SecReT4
Protein ID: 305667860
T4SS name [ID]Tra_I [165]
Gene symboltraM
Locus tagpCT_080
StrainEscherichia coli plasmid pCT (NC_014477)
Repliconplasmid pCT [GenBank: NC_014477] [Browse all T4SS(s) in this replicon]
Location [Strand]62837..63532 [-]
Productconjugal transfer protein
Component typeTraM_I
UniProt IDE0WH18
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 1e-33, Aligned region: 78..185
Protein Sequence: 231 a.a.     [Download]
>gi|305667860|ref|YP_003864334.1| conjugal transfer protein [Escherichia coli]
MSEAQPTSPVSPEADNSGDIYNPVLRTIAQSEQRAALVPGLVRALLCSGAALCISLVANGIQYWHATGVT
REYFATDNGRLVRLAPTSQPAWSQSDVMNFGSMTLSEAFNLDFVHYRKQITTQAPRFSEAGFAGYVNALQ
ASNILDTIKKEKFNLTTTIGAGTLVNQGQMENGVWFWKFQYPVRMRLVGQTSTRPEQAFTFEITVRRVDP
RIKPGGMEISQMVSRNAAAGI
 
Nucleotide Sequence: 696 bp     [Download]
>gi|305667788|ref|NC_014477.1|:c63532-62837 Escherichia coli plasmid pCT, complete sequence
ATGAGCGAAGCACAACCCACCTCCCCTGTCTCACCGGAAGCGGATAACAGCGGAGATATTTATAACCCCG
TGCTCAGAACCATCGCACAGTCAGAACAACGGGCCGCGCTGGTACCCGGTCTGGTCAGGGCGTTGCTGTG
CAGCGGCGCAGCACTCTGCATCAGCCTGGTGGCTAATGGCATACAGTACTGGCATGCCACCGGCGTGACG
CGCGAATACTTTGCCACTGACAATGGCCGACTGGTCCGTCTGGCACCAACCAGCCAGCCGGCCTGGAGTC
AGAGCGACGTCATGAACTTTGGCAGCATGACGCTGAGCGAAGCCTTCAATCTCGATTTTGTCCACTACCG
AAAACAAATCACGACACAGGCCCCCCGCTTTTCCGAAGCCGGCTTTGCCGGCTATGTGAATGCCCTTCAG
GCCTCGAACATTCTCGACACTATTAAAAAGGAGAAATTTAACCTCACAACCACTATCGGGGCAGGTACCC
TGGTCAACCAGGGACAGATGGAGAACGGTGTCTGGTTCTGGAAATTCCAGTATCCGGTCAGGATGCGCCT
GGTCGGTCAGACCAGCACCCGCCCCGAACAGGCCTTCACCTTTGAAATCACTGTCCGGCGCGTTGACCCC
CGCATCAAACCCGGCGGCATGGAAATCAGCCAGATGGTTTCCCGTAACGCCGCAGCAGGAATCTGA
 Primer design