SecReT4
Protein ID: 305667861
T4SS name [ID]Tra_I [165]
Gene symboltraL
Locus tagpCT_081
StrainEscherichia coli plasmid pCT (NC_014477)
Repliconplasmid pCT [GenBank: NC_014477] [Browse all T4SS(s) in this replicon]
Location [Strand]63544..63894 [-]
Productconjugal transfer protein
Component typeTraL_I
UniProt IDC1J8N3, B7LIR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|305667861|ref|YP_003864335.1| conjugal transfer protein [Escherichia coli]
MNMKKTLLVILTGITLASPVAGAATCRAGAAAEAGSRAAWERARTASQAWSQRENDVASSLQSCLSRIKD
ISITLPQFPSLDKLLRDLENQVCDAVVDRVNDHLPGNIDPWKDYNL
 
Nucleotide Sequence: 351 bp     [Download]
>gi|305667788|ref|NC_014477.1|:c63894-63544 Escherichia coli plasmid pCT, complete sequence
ATGAACATGAAAAAAACGCTGCTGGTCATACTGACCGGCATCACCCTGGCATCACCGGTGGCAGGTGCCG
CCACCTGCCGGGCGGGGGCCGCTGCCGAAGCCGGCAGCAGAGCCGCCTGGGAGCGGGCGCGCACAGCCAG
CCAGGCATGGTCACAGCGGGAGAATGACGTCGCCTCCTCCCTGCAGTCCTGCCTGTCCCGCATCAAGGAC
ATCAGTATCACTCTTCCGCAGTTCCCCAGCCTGGACAAGCTCCTCCGCGACCTGGAAAACCAGGTCTGTG
ATGCCGTCGTGGATCGGGTGAATGACCATCTTCCGGGGAATATCGACCCCTGGAAAGACTACAACCTCTG
A
 Primer design