SecReT4
Protein ID: 305678720
T4SS name [ID]Tra_p [641]
Gene symboltrsG
Locus tagpWZ1668_p43
StrainEnterococcus faecalis plasmid pWZ1668 (NC_014475)
Repliconplasmid pWZ1668 [GenBank: NC_014475] [Browse all T4SS(s) in this replicon]
Location [Strand]42786..43895 [+]
Productputative lytic transglycosylase
Component typeOrf7_p
UniProt IDE0X5C3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 2.6e-57, Aligned region: 53..210
CHAP [PF05257], Evalue: 2.8e-31, Aligned region: 247..363
SLT [PF01464], Evalue: 4.5e-05, Aligned region: 83..158
Protein Sequence: 369 a.a.     [Download]
>gi|305678720|ref|YP_003864139.1| putative lytic transglycosylase [Enterococcus faecalis]
MGATAAKLLIRYRKPIAKAILGFFVFIVVIFLLVFNNDQTAPSGGLATENQNLSESVLRYKRTVEKYARQ
YDGMEYVPYILALMQIESGGEGGDPMQSSESLGLPPNTIKDPERSIQRGVEFFVENMKSAINRGSDIKTA
LQAYNYGGGFVDFVVKNGGTYSFELAKQFSINMSGGEKVPYVNALSTSMGYNYRYNYGNMFYVPKLLEYV
NESQASAEGVQNNSNNTGVVQVDVPSEYKNKLRYPRYDGHNYNTSGSYPFGQCTWYAFNRMAQIGKPVDD
FMGNGGEWGYKGKALGYKVTNKPKVGTAISFPPGSFGSDPVYGHVAFVEVVNADGTLLVSECNVVNPGSG
TISYRVVPASIANIASYVE
 
Nucleotide Sequence: 1110 bp     [Download]
>gi|305678685|ref|NC_014475.1|:42786-43895 Enterococcus faecalis plasmid pWZ1668, complete sequence
ATGGGAGCAACAGCTGCTAAACTGCTTATTCGTTATCGAAAACCGATAGCGAAAGCAATTTTAGGCTTTT
TCGTCTTTATCGTTGTAATCTTCCTTCTTGTTTTTAATAACGATCAAACCGCCCCTAGTGGCGGACTAGC
AACAGAAAACCAAAATTTAAGTGAATCTGTTTTGAGGTACAAACGTACCGTTGAAAAGTACGCTAGACAA
TATGACGGTATGGAATATGTACCTTATATCTTAGCCCTTATGCAAATTGAATCAGGTGGTGAAGGTGGCG
ACCCTATGCAATCAAGCGAAAGTTTAGGACTGCCCCCGAACACTATTAAAGACCCCGAACGAAGTATACA
ACGAGGAGTAGAGTTTTTTGTAGAAAATATGAAAAGCGCTATAAACCGAGGATCAGATATAAAAACAGCT
CTTCAAGCGTATAATTATGGCGGTGGTTTTGTTGATTTTGTAGTGAAGAATGGCGGAACGTATTCTTTTG
AGTTGGCTAAACAATTTTCTATTAATATGTCAGGTGGCGAAAAGGTGCCTTATGTAAATGCTTTATCTAC
TTCAATGGGCTACAATTACCGCTATAACTACGGAAATATGTTCTATGTGCCAAAATTACTTGAATACGTT
AACGAAAGCCAGGCAAGCGCAGAGGGCGTTCAAAACAATTCTAATAATACTGGCGTTGTTCAAGTTGATG
TACCCAGCGAATACAAAAATAAATTACGTTATCCAAGATATGACGGACACAACTATAATACAAGCGGTAG
TTATCCATTTGGGCAATGTACCTGGTACGCTTTTAATCGTATGGCTCAAATAGGAAAACCAGTTGATGAT
TTTATGGGCAATGGTGGCGAATGGGGCTATAAAGGGAAAGCTTTAGGCTATAAAGTAACAAATAAGCCAA
AAGTAGGTACGGCAATTTCTTTCCCACCTGGTTCTTTTGGCTCTGATCCAGTTTACGGACACGTTGCCTT
TGTAGAAGTCGTAAATGCAGACGGTACGCTTCTTGTATCAGAGTGTAATGTAGTAAACCCAGGAAGCGGA
ACAATCAGTTATCGAGTAGTGCCAGCTTCTATTGCAAACATTGCAAGTTATGTTGAATAA
 Primer design