SecReT4
Protein ID: 305678725
T4SS name [ID]Tra_p [641]
Gene symboltrsL
Locus tagpWZ1668_p01
StrainEnterococcus faecalis plasmid pWZ1668 (NC_014475)
Repliconplasmid pWZ1668 [GenBank: NC_014475] [Browse all T4SS(s) in this replicon]
Location [Strand]47486..53 [+]
ProductTrsL
Component typeOrf12_p
UniProt IDE0X588
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 310 a.a.     [Download]
>gi|305678725|ref|YP_003864104.1| TrsL [Enterococcus faecalis]
MDVIDQIKETGSDILSSAGDAISGIFEGVKESVDSVLHPIDSLLGSWGSDLLEASMKIANKTTFDIPNIQ
LISTITNVFVFATTTFAICIVLYKVIEAQIQASNGSGDALTANIVQKLFYSSIALAVLPWAMNFFIKKIV
APIGEYVIQQVANDLNVETIGERLRNFLVSNFFNGGVSAVVLFVFVIFFAFSIAKYFVAICVFYADFLVL
TMLTPLVALSLLTDEQNYFQIWIKELLSEALTMLIKLILYLLMITLMIAEKYTLPNFMLMVGCGLLIIKT
PSALQNMWYSTKVSKGGGLGNLAMMAMFRK
 
Nucleotide Sequence: -47432 bp     [Download]
 Primer design