SecReT4
Protein ID: 305696905
T4SS name [ID]Tra_F [82]
Gene symbol-
Locus tagpYT1_p077
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]76009..76572 [-]
Productputative transglycosylase
Component typeOrf169_F
UniProt IDE0D8F4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 187 a.a.     [Download]
>gi|305696905|ref|YP_003864220.1| putative transglycosylase [Salmonella enterica subsp. enterica serovar Typhimurium]
MVLLVVRTANLLSMELEWVKLLPDDYARGKLMYKWLLSVLLVLMSTVVHAADCFDLAGRDYKIDPDLLRA
ISWKESRNRANAVGINPVTGYGSGLMQVDSQHFNELARYGIKPEQLVSDPCLNIYTGAYYLAIAFRKWGV
SWTAVGAYNAGFKKTPLQDARRLDYATDVHRIWIAIKQSKTRQTPAR
 
Nucleotide Sequence: 564 bp     [Download]
>gi|305696832|ref|NC_014476.1|:c76572-76009 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
GTGGTGCTTTTGGTGGTGAGGACGGCAAATTTGTTGAGTATGGAGTTGGAGTGGGTTAAGTTATTACCGG
ATGACTACGCAAGAGGCAAATTAATGTATAAATGGCTCCTGTCTGTCCTCCTGGTATTAATGAGCACGGT
AGTCCATGCCGCTGACTGTTTTGATCTGGCCGGGAGAGACTATAAAATAGATCCGGATTTACTGCGGGCG
ATTTCATGGAAGGAATCCCGTAACCGGGCTAATGCCGTCGGTATTAATCCGGTTACGGGATATGGCTCGG
GGTTAATGCAGGTTGACTCTCAGCACTTTAACGAACTGGCTCGTTATGGAATAAAACCGGAACAACTTGT
CTCCGATCCCTGCCTGAATATTTACACCGGAGCTTATTATCTGGCAATCGCATTCAGAAAGTGGGGGGTA
TCCTGGACAGCAGTCGGAGCGTACAACGCCGGATTTAAAAAGACTCCCCTTCAGGATGCACGTCGTCTGG
ACTATGCGACTGATGTACACCGAATCTGGATCGCGATAAAACAAAGTAAAACCAGGCAGACTCCCGCCCG
ATGA
 Primer design

Protein ID: 305696906
T4SS name [ID]Tra_F [82]
Gene symbolfinP
Locus tagpYT1_p078
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]76009..76479 [-]
Productputative transglycosylase
Component typeOrf169_F
UniProt IDD0R7D3, H9L4E2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 156 a.a.     [Download]
>gi|305696906|ref|YP_003864221.1| putative transglycosylase [Salmonella enterica subsp. enterica serovar Typhimurium]
MYKWLLSVLLVLMSTVVHAADCFDLAGRDYKIDPDLLRAISWKESRNRANAVGINPVTGYGSGLMQVDSQ
HFNELARYGIKPEQLVSDPCLNIYTGAYYLAIAFRKWGVSWTAVGAYNAGFKKTPLQDARRLDYATDVHR
IWIAIKQSKTRQTPAR
 
Nucleotide Sequence: 471 bp     [Download]
>gi|305696832|ref|NC_014476.1|:c76479-76009 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGTATAAATGGCTCCTGTCTGTCCTCCTGGTATTAATGAGCACGGTAGTCCATGCCGCTGACTGTTTTG
ATCTGGCCGGGAGAGACTATAAAATAGATCCGGATTTACTGCGGGCGATTTCATGGAAGGAATCCCGTAA
CCGGGCTAATGCCGTCGGTATTAATCCGGTTACGGGATATGGCTCGGGGTTAATGCAGGTTGACTCTCAG
CACTTTAACGAACTGGCTCGTTATGGAATAAAACCGGAACAACTTGTCTCCGATCCCTGCCTGAATATTT
ACACCGGAGCTTATTATCTGGCAATCGCATTCAGAAAGTGGGGGGTATCCTGGACAGCAGTCGGAGCGTA
CAACGCCGGATTTAAAAAGACTCCCCTTCAGGATGCACGTCGTCTGGACTATGCGACTGATGTACACCGA
ATCTGGATCGCGATAAAACAAAGTAAAACCAGGCAGACTCCCGCCCGATGA
 Primer design