SecReT4
Protein ID: 305696907
T4SS name [ID]Tra_F [82]
Gene symbolTraM
Locus tagpYT1_p079
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]76894..77274 [+]
Productconjugative transfer protein
Component typeTraM_F
UniProt IDE0D8F6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 4e-55, Aligned region: 1..126
Protein Sequence: 126 a.a.     [Download]
>gi|305696907|ref|YP_003864222.1| conjugative transfer protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MAKVNVYISNEVHNKITAIVEKRRQEGARDKDISFSGTSSMLLELRLRVYEAQMERKESPFNQTEFNKVL
LENVLKTQSSVAKILGIGSLSPHVAGNPKFEYANMVEDIKEKVSSEMERFFHENEE
 
Nucleotide Sequence: 381 bp     [Download]
>gi|305696832|ref|NC_014476.1|:76894-77274 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGGCTAAAGTCAATGTATATATAAGTAATGAGGTACACAATAAAATAACTGCTATTGTGGAAAAACGAC
GCCAGGAAGGGGCGAGAGATAAAGATATCAGTTTTTCTGGTACATCTTCGATGTTGCTGGAATTAAGGCT
TCGTGTCTATGAGGCACAAATGGAGCGTAAGGAGTCGCCATTTAATCAGACAGAATTCAATAAAGTATTA
CTTGAAAATGTACTTAAAACACAGTCATCCGTAGCCAAAATTTTAGGTATAGGATCTCTCAGCCCTCATG
TCGCCGGAAATCCAAAATTTGAATATGCAAATATGGTTGAAGATATCAAAGAAAAAGTATCTTCAGAGAT
GGAAAGATTTTTCCATGAAAATGAAGAATAA
 Primer design