SecReT4
Protein ID: 305696909
T4SS name [ID]Tra_F [82]
Gene symbolTraY
Locus tagpYT1_p081
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]78154..78474 [+]
Productconjugative transfer oriT nicking protein
Component typeTraY_F
UniProt IDD0R7D6, Q9X9C6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 7.8e-23, Aligned region: 45..92
Protein Sequence: 106 a.a.     [Download]
>gi|305696909|ref|YP_003864224.1| conjugative transfer oriT nicking protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MLIKARHFWRVFFCRFPCNHKFISRVSRGEFVRRRNAREGISRTVSVYLDEDTNNRLIRAKDRSGRSKTI
EVQIRLRDHLKRYPDFYNEEIFREVIEETESTFKEI
 
Nucleotide Sequence: 321 bp     [Download]
>gi|305696832|ref|NC_014476.1|:78154-78474 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGTTAATTAAGGCGCGCCATTTTTGGCGTGTTTTTTTTTGCCGTTTTCCGTGTAATCATAAGTTTATTA
GTCGTGTAAGCAGAGGTGAATTTGTGAGGAGGAGAAACGCAAGAGAGGGGATAAGTCGAACTGTCTCAGT
GTATCTCGATGAAGATACGAATAACCGTCTTATCAGGGCTAAAGATCGGAGTGGAAGAAGTAAAACAATA
GAAGTTCAGATTCGTCTGAGGGATCATCTGAAACGATATCCGGATTTCTATAATGAAGAAATTTTCAGGG
AGGTAATTGAAGAAACAGAGTCCACATTTAAAGAGATTTAA
 Primer design