SecReT4
Protein ID: 305696910
T4SS name [ID]Tra_F [82]
Gene symbolTraA
Locus tagpYT1_p082
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]78516..78878 [+]
Productconjugative transfer fimbrial subunit
Component typeTraA_F
UniProt IDQ9X9C7, D0R7D7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 4.8e-53, Aligned region: 1..119
Protein Sequence: 120 a.a.     [Download]
>gi|305696910|ref|YP_003864225.1| conjugative transfer fimbrial subunit [Salmonella enterica subsp. enterica serovar Typhimurium]
MSAILSVQGASAPVKKKSFLSTFTRLNLLKLARAVIPAAVLIFFFPQLAMAAGGSQDLMASGNGTVKATF
GKDSSAVKWVILAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL
 
Nucleotide Sequence: 363 bp     [Download]
>gi|305696832|ref|NC_014476.1|:78516-78878 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGAGCGCTATTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTTAAAAAGAAATCGTTTCTGTCTACGTTCA
CACGTCTGAACCTGCTGAAACTTGCCCGCGCAGTGATCCCGGCGGCAGTACTGATATTCTTTTTCCCGCA
ACTGGCAATGGCTGCCGGCGGTTCGCAGGACCTGATGGCCAGCGGTAACGGTACGGTCAAGGCGACATTT
GGTAAGGATTCCAGCGCCGTCAAGTGGGTTATTCTCGCGGAAGTGCTGGTCGGTGCCGTGATGTACATGA
TGACCAAGAACGTCAAATTCCTGGCGGGTTTTGCCATCATCTCGGTCTTTATTGCCGTTGGTATGGCTGT
CGTCGGCCTCTGA
 Primer design