SecReT4
Protein ID: 305696911
T4SS name [ID]Tra_F [82]
Gene symbolTraL
Locus tagpYT1_p083
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]78893..79204 [+]
Productconjugal transfer pilus assembly protein
Component typeTraL_F
UniProt IDQ9X9C8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.8e-38, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|305696911|ref|YP_003864226.1| conjugal transfer pilus assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MSGDENKLRKYRFPETLTNQSRWFGLPVDELIPAAVCIGWGLMTSKQLFGISAAVLVYFGIRKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|305696832|ref|NC_014476.1|:78893-79204 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGTCGGGAGACGAGAATAAACTCAGGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCGGTGGATGAATTAATTCCTGCTGCTGTCTGTATTGGCTGGGGATTAATGACATCAAAACA
ACTTTTCGGCATCAGCGCTGCGGTTCTGGTTTATTTCGGGATAAGAAAACTGAAAAAAGGGCGGGGAAGC
TCCTGGCTGCGTGACCTGATTTACTGGTATATGCCGACAGCCCTGCTTCGCGGTATTTTTCATAACGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAGTAA
 Primer design